DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ben and UBC11

DIOPT Version :9

Sequence 1:NP_001162752.1 Gene:ben / 32358 FlyBaseID:FBgn0000173 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_014984.3 Gene:UBC11 / 854517 SGDID:S000005866 Length:156 Species:Saccharomyces cerevisiae


Alignment Length:131 Identity:54/131 - (41%)
Similarity:82/131 - (62%) Gaps:1/131 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RRIIKETQRLMQEPVPGINAIP-DENNARYFHVIVTGPNDSPFEGGVFKLELFLPEDYPMSAPKV 69
            :|:..|..:|:......|:|.| |:|:..|:...:|||.|:|:.|..||:.|..|::||...|.:
Yeast    11 KRLQNELLQLLSSTTESISAFPVDDNDLTYWVGYITGPKDTPYSGLKFKVSLKFPQNYPFHPPMI 75

  Fly    70 RFITKIYHPNIDRLGRICLDVLKDKWSPALQIRTILLSIQALLSAPNPDDPLANDVAELWKVNEA 134
            :|::.::|||:|:.|.||||:||:|||....:.|||||:|:||..||...||....||||..:..
Yeast    76 KFLSPMWHPNVDKSGNICLDILKEKWSAVYNVETILLSLQSLLGEPNNRSPLNAVAAELWDADME 140

  Fly   135 E 135
            |
Yeast   141 E 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
benNP_001162752.1 UBCc 3..149 CDD:412187 54/131 (41%)
UBC11NP_014984.3 COG5078 11..156 CDD:227410 54/131 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.