DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ben and PEX4

DIOPT Version :9

Sequence 1:NP_001162752.1 Gene:ben / 32358 FlyBaseID:FBgn0000173 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_011649.1 Gene:PEX4 / 853034 SGDID:S000003365 Length:183 Species:Saccharomyces cerevisiae


Alignment Length:146 Identity:44/146 - (30%)
Similarity:77/146 - (52%) Gaps:17/146 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RIIKETQRLMQ---------EPVPGI----NAIPDENNARYFHVIVTGPNDSPFEGGVFKLELFL 58
            ||:||.:.:::         .|..||    |.| ||.:...:..|::||:|:|:|...|::.:.:
Yeast    21 RIVKEYKVILKTLASDDPIANPYRGIIESLNPI-DETDLSKWEAIISGPSDTPYENHQFRILIEV 84

  Fly    59 PEDYPMSAPKVRFI-TKIYHPNI-DRLGRICLDVLK-DKWSPALQIRTILLSIQALLSAPNPDDP 120
            |..|||:.||:.|: ..|.|.|: ...|.|||::|| ::|:|...:...:.::..||..|..|.|
Yeast    85 PSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWRLLREPVCDSP 149

  Fly   121 LANDVAELWKVNEAEA 136
            |..|:..:.:..:..|
Yeast   150 LDVDIGNIIRCGDMSA 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
benNP_001162752.1 UBCc 3..149 CDD:412187 44/146 (30%)
PEX4NP_011649.1 COG5078 15..176 CDD:227410 44/146 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.