DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ben and UBC13

DIOPT Version :9

Sequence 1:NP_001162752.1 Gene:ben / 32358 FlyBaseID:FBgn0000173 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_010377.3 Gene:UBC13 / 851666 SGDID:S000002499 Length:153 Species:Saccharomyces cerevisiae


Alignment Length:148 Identity:105/148 - (70%)
Similarity:125/148 - (84%) Gaps:0/148 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSLPRRIIKETQRLMQEPVPGINAIPDENNARYFHVIVTGPNDSPFEGGVFKLELFLPEDYPMS 65
            |:|||:||||||::|:.:|||||.|.|.::|.|||.|.:.||..||:|.|:|:|||:||:||||.
Yeast     1 MASLPKRIIKETEKLVSDPVPGITAEPHDDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPME 65

  Fly    66 APKVRFITKIYHPNIDRLGRICLDVLKDKWSPALQIRTILLSIQALLSAPNPDDPLANDVAELWK 130
            ||||||:||||||||||||||||||||..|||||||||:||||||||::|||:|||||||||.|.
Yeast    66 APKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWI 130

  Fly   131 VNEAEAIRNAREWTQKYA 148
            .||..|...|||||:.||
Yeast   131 KNEQGAKAKAREWTKLYA 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
benNP_001162752.1 UBCc 3..149 CDD:412187 104/146 (71%)
UBC13NP_010377.3 UBCc 3..152 CDD:412187 104/146 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 211 1.000 Domainoid score I501
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H100734
Inparanoid 1 1.050 225 1.000 Inparanoid score I754
Isobase 1 0.950 - 0 Normalized mean entropy S62
OMA 1 1.010 - - QHG53976
OrthoFinder 1 1.000 - - FOG0002236
OrthoInspector 1 1.000 - - otm46686
orthoMCL 1 0.900 - - OOG6_101934
Panther 1 1.100 - - LDO PTHR24068
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1581
SonicParanoid 1 1.000 - - X1478
TreeFam 1 0.960 - -
1514.810

Return to query results.
Submit another query.