DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ben and UBC35

DIOPT Version :9

Sequence 1:NP_001162752.1 Gene:ben / 32358 FlyBaseID:FBgn0000173 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_565192.1 Gene:UBC35 / 844224 AraportID:AT1G78870 Length:153 Species:Arabidopsis thaliana


Alignment Length:147 Identity:112/147 - (76%)
Similarity:133/147 - (90%) Gaps:0/147 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSLPRRIIKETQRLMQEPVPGINAIPDENNARYFHVIVTGPNDSPFEGGVFKLELFLPEDYPMSA 66
            |:||||||||||||:.||.|||:|.|.|:|.|||:|::.||..||:|||||||||||||:|||:|
plant     4 SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEEYPMAA 68

  Fly    67 PKVRFITKIYHPNIDRLGRICLDVLKDKWSPALQIRTILLSIQALLSAPNPDDPLANDVAELWKV 131
            |||||:|||||||||:|||||||:|||||||||||||:|||||||||||||||||:.::|:.||.
plant    69 PKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKS 133

  Fly   132 NEAEAIRNAREWTQKYA 148
            |||||:..|:|||:.||
plant   134 NEAEAVDTAKEWTRLYA 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
benNP_001162752.1 UBCc 3..149 CDD:412187 111/146 (76%)
UBC35NP_565192.1 UBCc 6..150 CDD:412187 109/143 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 232 1.000 Domainoid score I644
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H100734
Inparanoid 1 1.050 245 1.000 Inparanoid score I1055
OMA 1 1.010 - - QHG53976
OrthoDB 1 1.010 - - D1345547at2759
OrthoFinder 1 1.000 - - FOG0002236
OrthoInspector 1 1.000 - - mtm1183
orthoMCL 1 0.900 - - OOG6_101934
Panther 1 1.100 - - LDO PTHR24068
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1478
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.