DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ben and UBC36

DIOPT Version :9

Sequence 1:NP_001162752.1 Gene:ben / 32358 FlyBaseID:FBgn0000173 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001185017.1 Gene:UBC36 / 838260 AraportID:AT1G16890 Length:162 Species:Arabidopsis thaliana


Alignment Length:156 Identity:112/156 - (71%)
Similarity:132/156 - (84%) Gaps:9/156 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSLPRRIIKETQRLMQE---------PVPGINAIPDENNARYFHVIVTGPNDSPFEGGVFKLELF 57
            |:||||||||||||:.|         |.|||:|.|.|.|.|||:|::.||..||:||||||||||
plant     4 SNLPRRIIKETQRLLSEPGNFITSFDPSPGISASPSEENMRYFNVMILGPTQSPYEGGVFKLELF 68

  Fly    58 LPEDYPMSAPKVRFITKIYHPNIDRLGRICLDVLKDKWSPALQIRTILLSIQALLSAPNPDDPLA 122
            |||:|||:||||||:|||||||||:|||||||:|||||||||||||:|||||||||||||||||:
plant    69 LPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLS 133

  Fly   123 NDVAELWKVNEAEAIRNAREWTQKYA 148
            .::|:.||.|||||:..|:|||:.||
plant   134 ENIAKHWKSNEAEAVETAKEWTRLYA 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
benNP_001162752.1 UBCc 3..149 CDD:412187 111/155 (72%)
UBC36NP_001185017.1 COG5078 1..160 CDD:227410 112/156 (72%)
UBCc 6..159 CDD:294101 109/152 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 232 1.000 Domainoid score I644
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 245 1.000 Inparanoid score I1055
OMA 1 1.010 - - QHG53976
OrthoDB 1 1.010 - - D1345547at2759
OrthoFinder 1 1.000 - - FOG0002236
OrthoInspector 1 1.000 - - mtm1183
orthoMCL 1 0.900 - - OOG6_101934
Panther 1 1.100 - - O PTHR24068
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1478
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.