DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ben and UBC37

DIOPT Version :10

Sequence 1:NP_511150.1 Gene:ben / 32358 FlyBaseID:FBgn0000173 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001325554.1 Gene:UBC37 / 822045 AraportID:AT3G24515 Length:434 Species:Arabidopsis thaliana


Alignment Length:114 Identity:55/114 - (48%)
Similarity:71/114 - (62%) Gaps:4/114 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 VTGPNDSPFEGGVFKLELFLPEDYPMSAPKVRFITKIYHPNIDRLGRICLDVL----KDKWSPAL 99
            :.||.|:.:..|:|.|::.:||.||...|.|.|.|.|||||||..||||||:|    |..|.|:|
plant    76 IEGPEDTVYANGIFNLKIQIPERYPFQPPIVSFATPIYHPNIDNSGRICLDILNLPPKGAWQPSL 140

  Fly   100 QIRTILLSIQALLSAPNPDDPLANDVAELWKVNEAEAIRNAREWTQKYA 148
            .|.|:|.|::.|||.|||||.|..:|:..:|.|.......|||.|:|||
plant   141 NISTVLTSMRLLLSEPNPDDGLMCEVSREYKYNRQTFDYKAREMTEKYA 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
benNP_511150.1 UBCc_UBE2N 4..147 CDD:467433 52/111 (47%)
UBC37NP_001325554.1 UBCc_UBE2T 10..188 CDD:467425 52/111 (47%)

Return to query results.
Submit another query.