DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ben and UBE2N

DIOPT Version :9

Sequence 1:NP_001162752.1 Gene:ben / 32358 FlyBaseID:FBgn0000173 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_003339.1 Gene:UBE2N / 7334 HGNCID:12492 Length:152 Species:Homo sapiens


Alignment Length:151 Identity:121/151 - (80%)
Similarity:137/151 - (90%) Gaps:0/151 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSLPRRIIKETQRLMQEPVPGINAIPDENNARYFHVIVTGPNDSPFEGGVFKLELFLPEDYPMS 65
            |:.||||||||||||:.||||||.|.|||:|||||||::.||.|||||||.|||||||||:|||:
Human     1 MAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMA 65

  Fly    66 APKVRFITKIYHPNIDRLGRICLDVLKDKWSPALQIRTILLSIQALLSAPNPDDPLANDVAELWK 130
            ||||||:|||||||:|:|||||||:|||||||||||||:|||||||||||||||||||||||.||
Human    66 APKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWK 130

  Fly   131 VNEAEAIRNAREWTQKYAVED 151
            .|||:||..||.||:.||:.:
Human   131 TNEAQAIETARAWTRLYAMNN 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
benNP_001162752.1 UBCc 3..149 CDD:412187 119/145 (82%)
UBE2NNP_003339.1 UBCc 4..151 CDD:412187 120/146 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146768
Domainoid 1 1.000 244 1.000 Domainoid score I2199
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 263 1.000 Inparanoid score I3090
Isobase 1 0.950 - 0 Normalized mean entropy S62
OMA 1 1.010 - - QHG53976
OrthoDB 1 1.010 - - D1345547at2759
OrthoFinder 1 1.000 - - FOG0002236
OrthoInspector 1 1.000 - - otm41590
orthoMCL 1 0.900 - - OOG6_101934
Panther 1 1.100 - - LDO PTHR24068
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1581
SonicParanoid 1 1.000 - - X1478
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.750

Return to query results.
Submit another query.