DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ben and Ube2g1

DIOPT Version :9

Sequence 1:NP_001162752.1 Gene:ben / 32358 FlyBaseID:FBgn0000173 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_080261.2 Gene:Ube2g1 / 67128 MGIID:1914378 Length:170 Species:Mus musculus


Alignment Length:161 Identity:55/161 - (34%)
Similarity:93/161 - (57%) Gaps:25/161 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LPRRIIKETQRLMQEPVPGINA-IPDENNARYFHVIVTGPNDSPFEGGVFKLELFLPEDYPMSAP 67
            |.||.:.|   |.:.||.|.:| :.|:|:...:.|::.||.|:.:||||||..|..|:|||:..|
Mouse     9 LLRRQLAE---LNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTFPKDYPLRPP 70

  Fly    68 KVRFITKIYHPNIDRLGRICLDVL-------------KDKWSPALQIRTILLSIQALLSAPNPDD 119
            |::|||:|:|||:|:.|.:|:.:|             :::|.|...:.||::|:.::|:.||.|.
Mouse    71 KMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMISVISMLADPNGDS 135

  Fly   120 PLANDVAELWKVNE--------AEAIRNARE 142
            |...|.|:.|:.:.        |..:|.::|
Mouse   136 PANVDAAKEWREDRNGEFKRKVARCVRKSQE 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
benNP_001162752.1 UBCc 3..149 CDD:412187 55/161 (34%)
Ube2g1NP_080261.2 UQ_con 10..161 CDD:395127 52/153 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.