DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ben and UBE2Z

DIOPT Version :9

Sequence 1:NP_001162752.1 Gene:ben / 32358 FlyBaseID:FBgn0000173 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_075567.2 Gene:UBE2Z / 65264 HGNCID:25847 Length:354 Species:Homo sapiens


Alignment Length:127 Identity:44/127 - (34%)
Similarity:73/127 - (57%) Gaps:13/127 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RIIKETQRLMQEPVPGINAIPDENNARYFHVIVTGPNDSPFEGGVFKLELFLPEDYPMSAPKVRF 71
            ||.::...:.:||.||:..:||..:....|.::|||.|:|:|||.|......|.|||:..|:|:.
Human   103 RIKRDIMSIYKEPPPGMFVVPDTVDMTKIHALITGPFDTPYEGGFFLFVFRCPPDYPIHPPRVKL 167

  Fly    72 ITK-----IYHPNIDRLGRICLDVL----KDKWSPALQIRTILLSIQALLSAPNPDDPLAND 124
            :|.     .::||..|.|::||.:|    ...||||..|.::|:|||:|::    ::|..|:
Human   168 MTTGNNTVRFNPNFYRNGKVCLSILGTWTGPAWSPAQSISSVLISIQSLMT----ENPYHNE 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
benNP_001162752.1 UBCc 3..149 CDD:412187 44/127 (35%)
UBE2ZNP_075567.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
UBCc 103..221 CDD:238117 42/121 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 332..354
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.