DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ben and ube2l3

DIOPT Version :9

Sequence 1:NP_001162752.1 Gene:ben / 32358 FlyBaseID:FBgn0000173 Length:151 Species:Drosophila melanogaster
Sequence 2:XP_031755551.1 Gene:ube2l3 / 548817 XenbaseID:XB-GENE-970758 Length:160 Species:Xenopus tropicalis


Alignment Length:147 Identity:49/147 - (33%)
Similarity:85/147 - (57%) Gaps:5/147 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LPRRIIKETQRLMQEPVPGIN--AIPDENNARYFHVIVTGPNDSPFEGGVFKLELFLPEDYPMSA 66
            |...::.|.:.:.:..:....  .:.|.|...:..:||  |::.|::.|.|::|:..|.:||...
 Frog     9 LAHTVVMELEEIRKTGMKNFRNIQVEDSNLLTWQGLIV--PDNPPYDKGAFRIEINFPAEYPFKP 71

  Fly    67 PKVRFITKIYHPNIDRLGRICLDVLK-DKWSPALQIRTILLSIQALLSAPNPDDPLANDVAELWK 130
            ||:.|.|||||||||..|::||.|:. :.|.||.:...::.|:.||::.|.|:.||..|:||.:.
 Frog    72 PKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYS 136

  Fly   131 VNEAEAIRNAREWTQKY 147
            .:..:..:||.|:|:||
 Frog   137 KDRKKFCKNAEEFTKKY 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
benNP_001162752.1 UBCc 3..149 CDD:412187 49/147 (33%)
ube2l3XP_031755551.1 UBCc 16..155 CDD:214562 48/140 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.