DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ben and ube2z

DIOPT Version :9

Sequence 1:NP_001162752.1 Gene:ben / 32358 FlyBaseID:FBgn0000173 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001007969.2 Gene:ube2z / 493338 XenbaseID:XB-GENE-990986 Length:313 Species:Xenopus tropicalis


Alignment Length:130 Identity:46/130 - (35%)
Similarity:77/130 - (59%) Gaps:19/130 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RIIKETQRLMQEPVPGINAIPDENNARYFHVIVTGPNDSPFEGGVFKLELFL---PEDYPMSAPK 68
            ||.::...:.:||.||:..:||.::....|.::|||.|:|:|||.|   |||   |.|||:..|:
 Frog    62 RIKRDIMSIYKEPPPGMFVVPDPHDMTKIHALITGPFDTPYEGGFF---LFLFRCPPDYPIHPPR 123

  Fly    69 VRFITK-----IYHPNIDRLGRICLDVL----KDKWSPALQIRTILLSIQALLSAPNPDDPLAND 124
            |:.:|.     .::||..|.|::||.:|    ...||||..:.::|:|||:|::    ::|..|:
 Frog   124 VKLMTTGNNTVRFNPNFYRNGKVCLSILGTWTGPAWSPAQSLSSVLISIQSLMT----ENPYHNE 184

  Fly   125  124
             Frog   185  184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
benNP_001162752.1 UBCc 3..149 CDD:412187 46/130 (35%)
ube2zNP_001007969.2 UBCc 62..207 CDD:238117 46/130 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 283..313
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.