DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ben and ube2b

DIOPT Version :9

Sequence 1:NP_001162752.1 Gene:ben / 32358 FlyBaseID:FBgn0000173 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001005124.1 Gene:ube2b / 448706 XenbaseID:XB-GENE-1003709 Length:152 Species:Xenopus tropicalis


Alignment Length:130 Identity:54/130 - (41%)
Similarity:88/130 - (67%) Gaps:0/130 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RRIIKETQRLMQEPVPGINAIPDENNARYFHVIVTGPNDSPFEGGVFKLELFLPEDYPMSAPKVR 70
            ||::::.:||.::|..|::..|.|||...::.::.||..:|||.|.|||.:...|:||...|.||
 Frog     7 RRLMRDFKRLQEDPPVGVSGAPSENNIMVWNAVIFGPEGTPFEDGTFKLVIEFSEEYPNKPPTVR 71

  Fly    71 FITKIYHPNIDRLGRICLDVLKDKWSPALQIRTILLSIQALLSAPNPDDPLANDVAELWKVNEAE 135
            |::|::|||:...|.||||:|:::|||...:.:||.|||:||..|||:.|..:..|:|::.|:.|
 Frog    72 FVSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKRE 136

  Fly   136  135
             Frog   137  136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
benNP_001162752.1 UBCc 3..149 CDD:412187 54/130 (42%)
ube2bNP_001005124.1 UQ_con 8..145 CDD:395127 53/129 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.