DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ben and ube2k

DIOPT Version :9

Sequence 1:NP_001162752.1 Gene:ben / 32358 FlyBaseID:FBgn0000173 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001005662.1 Gene:ube2k / 448153 XenbaseID:XB-GENE-983372 Length:200 Species:Xenopus tropicalis


Alignment Length:151 Identity:68/151 - (45%)
Similarity:95/151 - (62%) Gaps:12/151 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RRIIKETQRLMQEPVPGINAIP----DENNARYFHVI---VTGPNDSPFEGGVFKLELFLPEDYP 63
            :||.:|.:.:::......|.|.    |||    |..:   :.||.|:|:|||.::||:.:||.||
 Frog     7 QRIKREFKEVLKSEETSKNQIKVDLVDEN----FSELRGEIAGPPDTPYEGGRYQLEIKIPETYP 67

  Fly    64 MSAPKVRFITKIYHPNIDRL-GRICLDVLKDKWSPALQIRTILLSIQALLSAPNPDDPLANDVAE 127
            .:.|||||||||:||||..: |.||||:|||:|:.|:.:||:|||:||||:|..||||....||.
 Frog    68 FNPPKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVAN 132

  Fly   128 LWKVNEAEAIRNAREWTQKYA 148
            .:|.|.....:.||.|...||
 Frog   133 QYKQNPEMFKQTARLWAHVYA 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
benNP_001162752.1 UBCc 3..149 CDD:412187 68/151 (45%)
ube2kNP_001005662.1 UQ_con 8..149 CDD:365926 65/144 (45%)
UBA_II_E2_UBE2K 163..200 CDD:270573
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.