DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ben and Ubc7

DIOPT Version :9

Sequence 1:NP_001162752.1 Gene:ben / 32358 FlyBaseID:FBgn0000173 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001285334.1 Gene:Ubc7 / 44054 FlyBaseID:FBgn0267384 Length:167 Species:Drosophila melanogaster


Alignment Length:155 Identity:53/155 - (34%)
Similarity:82/155 - (52%) Gaps:14/155 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RRIIKETQRLMQEPVPGINAIP-DENNARYFHVIVTGPNDSPFEGGVFKLELFLPEDYPMSAPKV 69
            ||::.|.::|..:|..||.|.| .|:|...:..::.||..:.||||||...|..|.|||:|.||:
  Fly     7 RRLMAEYKQLTLDPPEGIVAGPISEDNFFEWEALIAGPEGTCFEGGVFPARLIFPTDYPLSPPKM 71

  Fly    70 RFITKIYHPNIDRLGRICLDVL-------------KDKWSPALQIRTILLSIQALLSAPNPDDPL 121
            :|...::||||...||:|:.:|             .::|||...:..||||:.::|:.||.:...
  Fly    72 KFTCDMFHPNIFADGRVCISILHAPGDDPMGYELSAERWSPVQSVEKILLSVVSMLAEPNDESGA 136

  Fly   122 ANDVAELWKVNEAEAIRNAREWTQK 146
            ..|.|.:|:....|....||...:|
  Fly   137 NVDAAIMWREQRDEFNAIARRLVRK 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
benNP_001162752.1 UBCc 3..149 CDD:412187 53/155 (34%)
Ubc7NP_001285334.1 COG5078 1..163 CDD:227410 53/155 (34%)
UQ_con 8..159 CDD:278603 51/150 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438109
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.