DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ben and Ubc84D

DIOPT Version :9

Sequence 1:NP_001162752.1 Gene:ben / 32358 FlyBaseID:FBgn0000173 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_524260.1 Gene:Ubc84D / 40900 FlyBaseID:FBgn0017456 Length:153 Species:Drosophila melanogaster


Alignment Length:146 Identity:47/146 - (32%)
Similarity:82/146 - (56%) Gaps:5/146 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RRIIKETQRLMQEPVPGINAI--PDENNARYFHVIVTGPNDSPFEGGVFKLELFLPEDYPMSAPK 68
            ||:.:|...|::..:..:..|  .||:...:..::|  |..:|:..|.|::|:..|..||...||
  Fly     5 RRLTRELSDLVEAKMSTLRNIESSDESLLMWTGLLV--PEKAPYNKGAFRIEINFPPQYPFMPPK 67

  Fly    69 VRFITKIYHPNIDRLGRICLDVLK-DKWSPALQIRTILLSIQALLSAPNPDDPLANDVAELWKVN 132
            :.|.|||||||:|..|.:||.::. |.|.|..:...:|.::.|::..|.|:.||.:|:||.:...
  Fly    68 ILFKTKIYHPNVDEKGEVCLPIISTDNWKPTTRTEQVLQALVAIVHNPEPEHPLRSDLAEEFVRE 132

  Fly   133 EAEAIRNAREWTQKYA 148
            ..:.::.|.|:|:|.|
  Fly   133 HKKFMKTAEEFTKKNA 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
benNP_001162752.1 UBCc 3..149 CDD:412187 47/146 (32%)
Ubc84DNP_524260.1 COG5078 1..150 CDD:227410 47/146 (32%)
UBCc 6..149 CDD:214562 46/145 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.