DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ben and CG7656

DIOPT Version :9

Sequence 1:NP_001162752.1 Gene:ben / 32358 FlyBaseID:FBgn0000173 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_648783.4 Gene:CG7656 / 39691 FlyBaseID:FBgn0036516 Length:319 Species:Drosophila melanogaster


Alignment Length:144 Identity:50/144 - (34%)
Similarity:80/144 - (55%) Gaps:16/144 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSLPRRIIKETQRLMQEPVPG--INAIPDENNARYFHVIVTGPNDSPFEGGVFKLELFLPEDYPM 64
            ||..|.:..|.:.|.:|||.|  :..|.|:|...: .|.:.||.|:.::||.||..:..|.|||.
  Fly    39 SSAVRALAMEYKSLQEEPVEGFRVKLINDDNLFEW-EVAIFGPPDTLYQGGYFKAHMKFPHDYPY 102

  Fly    65 SAPKVRFITKIYHPNIDRLGRICLDVLK-------------DKWSPALQIRTILLSIQALLSAPN 116
            |.|.:||:||::|||:...|.:|:.:|.             ::|:|...:||||||:.:||:.||
  Fly   103 SPPSIRFLTKVWHPNVYENGDLCISILHPPVDDPQSGELPCERWNPTQNVRTILLSVISLLNEPN 167

  Fly   117 PDDPLANDVAELWK 130
            ...|...|.:.:::
  Fly   168 TFSPANVDASVMYR 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
benNP_001162752.1 UBCc 3..149 CDD:412187 49/143 (34%)
CG7656NP_648783.4 UBCc 42..186 CDD:238117 48/141 (34%)
COG5078 45..182 CDD:227410 47/138 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438127
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.