DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ben and ube2n

DIOPT Version :9

Sequence 1:NP_001162752.1 Gene:ben / 32358 FlyBaseID:FBgn0000173 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_989375.1 Gene:ube2n / 395006 XenbaseID:XB-GENE-943749 Length:152 Species:Xenopus tropicalis


Alignment Length:151 Identity:121/151 - (80%)
Similarity:137/151 - (90%) Gaps:0/151 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSLPRRIIKETQRLMQEPVPGINAIPDENNARYFHVIVTGPNDSPFEGGVFKLELFLPEDYPMS 65
            |:.||||||||||||:.||||||.|.|||||||||||::.||.|||||||.|||||||||:|||:
 Frog     1 MAGLPRRIIKETQRLLAEPVPGIKAEPDENNARYFHVLIAGPQDSPFEGGTFKLELFLPEEYPMA 65

  Fly    66 APKVRFITKIYHPNIDRLGRICLDVLKDKWSPALQIRTILLSIQALLSAPNPDDPLANDVAELWK 130
            ||||||:|||||||:|:|||||||:|||||||||||||:|||||||||||||||||||||||.||
 Frog    66 APKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWK 130

  Fly   131 VNEAEAIRNAREWTQKYAVED 151
            .|||:||..||.||:.:|:.:
 Frog   131 TNEAQAIETARAWTRLHAMNN 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
benNP_001162752.1 UBCc 3..149 CDD:412187 119/145 (82%)
ube2nNP_989375.1 UBCc 4..151 CDD:381827 120/146 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 233 1.000 Domainoid score I2345
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 237 1.000 Inparanoid score I3294
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1345547at2759
OrthoFinder 1 1.000 - - FOG0002236
OrthoInspector 1 1.000 - - otm48054
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1478
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.