DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ben and CG17030

DIOPT Version :9

Sequence 1:NP_001162752.1 Gene:ben / 32358 FlyBaseID:FBgn0000173 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_647941.1 Gene:CG17030 / 38591 FlyBaseID:FBgn0035584 Length:180 Species:Drosophila melanogaster


Alignment Length:164 Identity:41/164 - (25%)
Similarity:79/164 - (48%) Gaps:38/164 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PRRIIKETQRLMQEPVPGINAIPDENNARYFHVIV--------TG---PNDSPFEGGVFKLELFL 58
            |:|:.:|...:::          |:.|.::.:::|        ||   |...|::.|.:|:|:..
  Fly    12 PKRMNRELALMLE----------DKQNLQFRNLLVEPNNIYKWTGLLMPVAPPYDKGAYKMEIDF 66

  Fly    59 PEDYPMSAPKVRFITKIYHPNIDRLGRICLDVLK-DKWSPALQIRTILLSIQALLSAPNPDDPLA 122
            |.|||...|::...|::||.|::..|::|:.:|: :.|.|..:|..:|..:.|.::.|.|::   
  Fly    67 PLDYPFKPPRIHINTRMYHLNVNERGQVCVPILEVEHWIPTTRIDQVLQVLLATINDPQPEN--- 128

  Fly   123 NDVAELWKVNEAEAIRN--------AREWTQKYA 148
                 .|.:..|...||        |..|.|||:
  Fly   129 -----AWHIEMAGEYRNDPVRFFKMADAWVQKYS 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
benNP_001162752.1 UBCc 3..149 CDD:412187 41/164 (25%)
CG17030NP_647941.1 COG5078 12..158 CDD:227410 41/164 (25%)
UQ_con 14..153 CDD:278603 36/156 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.