DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ben and CG16894

DIOPT Version :9

Sequence 1:NP_001162752.1 Gene:ben / 32358 FlyBaseID:FBgn0000173 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_611455.1 Gene:CG16894 / 37280 FlyBaseID:FBgn0034483 Length:266 Species:Drosophila melanogaster


Alignment Length:112 Identity:34/112 - (30%)
Similarity:54/112 - (48%) Gaps:19/112 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LMQEPVPGINAIPD-ENNARYFHVIVTGPNDSPFEGGVFKLELFLPEDYP--MSAPKVRFITKIY 76
            |::|.:..|.|||. .....:|.||..  :...:.|.||:..:.|||::|  :|.|.|.|.|::.
  Fly    26 LVKEELKNIYAIPSYACGLHWFGVIFV--HSGIYAGSVFRFSILLPENFPADISLPTVVFSTEVL 88

  Fly    77 HPNIDRLGRIC-----LDV--LKDKW-SPALQIRTILLSIQALLSAP 115
            ||:      ||     ||:  ..::| .....|..:|..|||:.:.|
  Fly    89 HPH------ICPQNKTLDLAHFLNEWRKDEHHIWHVLRYIQAIFADP 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
benNP_001162752.1 UBCc 3..149 CDD:412187 34/112 (30%)
CG16894NP_611455.1 COG5078 20..176 CDD:227410 34/112 (30%)
UBCc 23..173 CDD:294101 34/112 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438112
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.