DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ben and Ube2t

DIOPT Version :9

Sequence 1:NP_001162752.1 Gene:ben / 32358 FlyBaseID:FBgn0000173 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001101814.2 Gene:Ube2t / 360847 RGDID:1310816 Length:204 Species:Rattus norvegicus


Alignment Length:146 Identity:63/146 - (43%)
Similarity:92/146 - (63%) Gaps:4/146 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RIIKETQRLMQEPVPGINAIPDENNARYFHVIVTGPNDSPFEGGVFKLELFLPEDYPMSAPKVRF 71
            |:.||...|..||.||:....:::........:.|..::|:|.|:|.||:.:||.||...|::||
  Rat     6 RLKKELHMLAIEPPPGVTCWQEKDKMDNLRAQILGGANTPYEKGIFTLEVIVPERYPFEPPQIRF 70

  Fly    72 ITKIYHPNIDRLGRICLDVL----KDKWSPALQIRTILLSIQALLSAPNPDDPLANDVAELWKVN 132
            :|.|||||||..||||||:|    |..|.|:|.|.|:|.|||.|::.|||||||..|::..:|.|
  Rat    71 LTPIYHPNIDSSGRICLDILKLPPKGAWRPSLNIATVLTSIQLLMAEPNPDDPLMADISSEFKYN 135

  Fly   133 EAEAIRNAREWTQKYA 148
            :...::.||:||:.:|
  Rat   136 KIAFVKKARQWTETHA 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
benNP_001162752.1 UBCc 3..149 CDD:412187 63/146 (43%)
Ube2tNP_001101814.2 UBCc 5..147 CDD:238117 60/140 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53976
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.