DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ben and CG4502

DIOPT Version :9

Sequence 1:NP_001162752.1 Gene:ben / 32358 FlyBaseID:FBgn0000173 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_609103.1 Gene:CG4502 / 34002 FlyBaseID:FBgn0031896 Length:306 Species:Drosophila melanogaster


Alignment Length:125 Identity:30/125 - (24%)
Similarity:58/125 - (46%) Gaps:27/125 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RRIIKETQRL--MQEPVPGINAIPDENNARY-----FHVIVTGPNDSPF-----EGGV--FKLEL 56
            ||::||.:.:  :|.....:..:...|::.:     .|||   ..|||.     |.||  ..|.|
  Fly   141 RRLMKEYREMERLQAKNDAVFTVELVNDSLFEWHVRLHVI---DPDSPLARDMAEMGVPAILLHL 202

  Fly    57 FLPEDYPMSAPKVRFITKIYHPNIDR-----LGRICLDVLKDK-WSPALQIRTILLSIQA 110
            ..|:::|.:.|.:|    :..|:|::     .|.||:::|..: |:.|..:..:::...|
  Fly   203 SFPDNFPFAPPFMR----VVEPHIEKGYVMEGGAICMELLTPRGWASAYTVEAVIMQFAA 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
benNP_001162752.1 UBCc 3..149 CDD:412187 30/125 (24%)
CG4502NP_609103.1 UBCc 140..>258 CDD:238117 29/123 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.