DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ben and CG4502

DIOPT Version :10

Sequence 1:NP_511150.1 Gene:ben / 32358 FlyBaseID:FBgn0000173 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_609103.1 Gene:CG4502 / 34002 FlyBaseID:FBgn0031896 Length:306 Species:Drosophila melanogaster


Alignment Length:125 Identity:30/125 - (24%)
Similarity:58/125 - (46%) Gaps:27/125 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RRIIKETQRL--MQEPVPGINAIPDENNARY-----FHVIVTGPNDSPF-----EGGV--FKLEL 56
            ||::||.:.:  :|.....:..:...|::.:     .|||   ..|||.     |.||  ..|.|
  Fly   141 RRLMKEYREMERLQAKNDAVFTVELVNDSLFEWHVRLHVI---DPDSPLARDMAEMGVPAILLHL 202

  Fly    57 FLPEDYPMSAPKVRFITKIYHPNIDR-----LGRICLDVLKDK-WSPALQIRTILLSIQA 110
            ..|:::|.:.|.:|    :..|:|::     .|.||:::|..: |:.|..:..:::...|
  Fly   203 SFPDNFPFAPPFMR----VVEPHIEKGYVMEGGAICMELLTPRGWASAYTVEAVIMQFAA 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
benNP_511150.1 UBCc_UBE2N 4..147 CDD:467433 30/125 (24%)
CG4502NP_609103.1 UBCc_UBE2Q 141..293 CDD:467422 30/125 (24%)

Return to query results.
Submit another query.