DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ben and UbcE2H

DIOPT Version :9

Sequence 1:NP_001162752.1 Gene:ben / 32358 FlyBaseID:FBgn0000173 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_572438.1 Gene:UbcE2H / 31728 FlyBaseID:FBgn0029996 Length:183 Species:Drosophila melanogaster


Alignment Length:153 Identity:56/153 - (36%)
Similarity:85/153 - (55%) Gaps:16/153 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RRIIKETQRLMQEP-----VPGINAIPDENNARYFHVIVTGPNDSPFEGGVFKLELFLPEDYPMS 65
            ||:..:..:|::..     :.|:|.         |||...||.::|:||||:|:.::||::||..
  Fly     9 RRMDNDVIKLIESKHEVTILGGLNE---------FHVKFFGPTETPYEGGVWKVRVYLPDNYPFK 64

  Fly    66 APKVRFITKIYHPNIDR-LGRICLDVLKDKWSPALQIRTILLS-IQALLSAPNPDDPLANDVAEL 128
            :|.:.|:.||||||||. .|.:||||:...|:....:..|..| :..||:.|||.|||..|.|.|
  Fly    65 SPSIGFVNKIYHPNIDESSGTVCLDVINQAWTALYDLSNIFESFLPQLLTYPNPVDPLNRDAAAL 129

  Fly   129 WKVNEAEAIRNAREWTQKYAVED 151
            :.....|..|...::.|:||.||
  Fly   130 YLHEPEEYHRKVADYVQRYATED 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
benNP_001162752.1 UBCc 3..149 CDD:412187 53/149 (36%)
UbcE2HNP_572438.1 COG5078 1..149 CDD:227410 52/148 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438130
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.