DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ben and UbcE2H

DIOPT Version :10

Sequence 1:NP_511150.1 Gene:ben / 32358 FlyBaseID:FBgn0000173 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_572438.1 Gene:UbcE2H / 31728 FlyBaseID:FBgn0029996 Length:183 Species:Drosophila melanogaster


Alignment Length:153 Identity:56/153 - (36%)
Similarity:85/153 - (55%) Gaps:16/153 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RRIIKETQRLMQEP-----VPGINAIPDENNARYFHVIVTGPNDSPFEGGVFKLELFLPEDYPMS 65
            ||:..:..:|::..     :.|:|.         |||...||.::|:||||:|:.::||::||..
  Fly     9 RRMDNDVIKLIESKHEVTILGGLNE---------FHVKFFGPTETPYEGGVWKVRVYLPDNYPFK 64

  Fly    66 APKVRFITKIYHPNIDR-LGRICLDVLKDKWSPALQIRTILLS-IQALLSAPNPDDPLANDVAEL 128
            :|.:.|:.||||||||. .|.:||||:...|:....:..|..| :..||:.|||.|||..|.|.|
  Fly    65 SPSIGFVNKIYHPNIDESSGTVCLDVINQAWTALYDLSNIFESFLPQLLTYPNPVDPLNRDAAAL 129

  Fly   129 WKVNEAEAIRNAREWTQKYAVED 151
            :.....|..|...::.|:||.||
  Fly   130 YLHEPEEYHRKVADYVQRYATED 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
benNP_511150.1 UBCc_UBE2N 4..147 CDD:467433 52/147 (35%)
UbcE2HNP_572438.1 UBCc_UBE2H 9..145 CDD:467417 51/144 (35%)

Return to query results.
Submit another query.