DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ben and Ube2o

DIOPT Version :9

Sequence 1:NP_001162752.1 Gene:ben / 32358 FlyBaseID:FBgn0000173 Length:151 Species:Drosophila melanogaster
Sequence 2:XP_221132.5 Gene:Ube2o / 303689 RGDID:1310297 Length:1291 Species:Rattus norvegicus


Alignment Length:157 Identity:36/157 - (22%)
Similarity:68/157 - (43%) Gaps:20/157 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IKETQRLMQEPVP-GINAIPDENNARYFHVIVTGPNDSPFEGGVFKLELFLPEDYPMSAPKVRFI 72
            :::...|:...:| ||.....|:....|..::.||..:|:|.|::..::.||..||...|...::
  Rat   958 VRKEMALLATSLPDGIMVKTFEDRMDLFSALIKGPTRTPYEDGLYLFDIQLPNIYPAVPPHFCYL 1022

  Fly    73 TKI---YHPNIDRLGRICLDVL-------KDKWSPALQIRTILLSIQALLSAPNP---------D 118
            ::.   .:||:...|::|:.:|       .::|:....:..:|:|||.|:....|         |
  Rat  1023 SQCSGRLNPNLYDNGKVCVSLLGTWIGKGTERWTSKSSLLQVLISIQGLILVNEPYYNEAGFDSD 1087

  Fly   119 DPLANDVAELWKVNEAEAIRNAREWTQ 145
            ..|..........||...||..:..||
  Rat  1088 RGLQEGYENSRCYNEMALIRVVQSMTQ 1114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
benNP_001162752.1 UBCc 3..149 CDD:412187 36/157 (23%)
Ube2oXP_221132.5 UBCc 958..1108 CDD:238117 33/149 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.