DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ben and Ube2k

DIOPT Version :10

Sequence 1:NP_511150.1 Gene:ben / 32358 FlyBaseID:FBgn0000173 Length:151 Species:Drosophila melanogaster
Sequence 2:XP_038947644.1 Gene:Ube2k / 289623 RGDID:1311626 Length:210 Species:Rattus norvegicus


Alignment Length:111 Identity:59/111 - (53%)
Similarity:79/111 - (71%) Gaps:1/111 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 VTGPNDSPFEGGVFKLELFLPEDYPMSAPKVRFITKIYHPNIDRL-GRICLDVLKDKWSPALQIR 102
            :.||.|:|:|||.::||:.:||.||.:.|||||||||:||||..: |.||||:|||:|:.|:.:|
  Rat    53 IAGPPDTPYEGGRYQLEIKIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLR 117

  Fly   103 TILLSIQALLSAPNPDDPLANDVAELWKVNEAEAIRNAREWTQKYA 148
            |:|||:||||:|..||||....||..:|.|.....:.||.|...||
  Rat   118 TVLLSLQALLAAAEPDDPQDAVVANQYKQNPEMFKQTARLWAHVYA 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
benNP_511150.1 UBCc_UBE2N 4..147 CDD:467433 57/108 (53%)
Ube2kXP_038947644.1 UBCc_UBE2K 31..161 CDD:467420 57/107 (53%)
UBA_II_E2_UBE2K 173..210 CDD:270573
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.