DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ben and UBE2S

DIOPT Version :9

Sequence 1:NP_001162752.1 Gene:ben / 32358 FlyBaseID:FBgn0000173 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_055316.2 Gene:UBE2S / 27338 HGNCID:17895 Length:222 Species:Homo sapiens


Alignment Length:149 Identity:58/149 - (38%)
Similarity:84/149 - (56%) Gaps:4/149 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSLPRRII----KETQRLMQEPVPGINAIPDENNARYFHVIVTGPNDSPFEGGVFKLELFLPED 61
            :.:||..||    ||...|..:|..||...|:|.:.....|.:.||..:|:.||:|:::|.|.:|
Human     5 VENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPEGTPYAGGLFRMKLLLGKD 69

  Fly    62 YPMSAPKVRFITKIYHPNIDRLGRICLDVLKDKWSPALQIRTILLSIQALLSAPNPDDPLANDVA 126
            :|.|.||..|:|||:|||:...|.||::|||..|:..|.||.:||:|:.||..|||:..|..:..
Human    70 FPASPPKGYFLTKIFHPNVGANGEICVNVLKRDWTAELGIRHVLLTIKCLLIHPNPESALNEEAG 134

  Fly   127 ELWKVNEAEAIRNAREWTQ 145
            .|...|..|....||..|:
Human   135 RLLLENYEEYAARARLLTE 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
benNP_001162752.1 UBCc 3..149 CDD:412187 58/147 (39%)
UBE2SNP_055316.2 UQ_con 16..152 CDD:306648 53/135 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 156..222
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.