DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ben and ubc13

DIOPT Version :9

Sequence 1:NP_001162752.1 Gene:ben / 32358 FlyBaseID:FBgn0000173 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_594929.1 Gene:ubc13 / 2542925 PomBaseID:SPAC11E3.04c Length:148 Species:Schizosaccharomyces pombe


Alignment Length:147 Identity:99/147 - (67%)
Similarity:119/147 - (80%) Gaps:0/147 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SLPRRIIKETQRLMQEPVPGINAIPDENNARYFHVIVTGPNDSPFEGGVFKLELFLPEDYPMSAP 67
            :||:|||||.:.|.::|.|||.|.|.|:|.|||.:.:.||..|.:|||.|.||||||::|||..|
pombe     2 ALPKRIIKEIETLTRDPPPGIVAAPTEDNLRYFKITMEGPQQSAYEGGKFHLELFLPDEYPMMPP 66

  Fly    68 KVRFITKIYHPNIDRLGRICLDVLKDKWSPALQIRTILLSIQALLSAPNPDDPLANDVAELWKVN 132
            .|||:|||||||:|:||||||..||..|||||||||:|||||||:.||||||||.||||::||.|
pombe    67 NVRFLTKIYHPNVDKLGRICLSTLKKDWSPALQIRTVLLSIQALMGAPNPDDPLDNDVAKIWKEN 131

  Fly   133 EAEAIRNAREWTQKYAV 149
            |.:||.||||||:||||
pombe   132 EPQAIANAREWTKKYAV 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
benNP_001162752.1 UBCc 3..149 CDD:412187 97/145 (67%)
ubc13NP_594929.1 UBCc 1..148 CDD:294101 97/145 (67%)
COG5078 4..148 CDD:227410 96/143 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 196 1.000 Domainoid score I690
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H100734
Inparanoid 1 1.050 216 1.000 Inparanoid score I928
OMA 1 1.010 - - QHG53976
OrthoFinder 1 1.000 - - FOG0002236
OrthoInspector 1 1.000 - - otm47146
orthoMCL 1 0.900 - - OOG6_101934
Panther 1 1.100 - - LDO PTHR24068
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1581
SonicParanoid 1 1.000 - - X1478
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.