DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ben and uev-3

DIOPT Version :9

Sequence 1:NP_001162752.1 Gene:ben / 32358 FlyBaseID:FBgn0000173 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001361859.1 Gene:uev-3 / 185003 WormBaseID:WBGene00006732 Length:356 Species:Caenorhabditis elegans


Alignment Length:159 Identity:41/159 - (25%)
Similarity:65/159 - (40%) Gaps:29/159 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IKETQRLMQEPVPGINAIPDENNARYFHVIVTGPNDSPFEGGVFKLELFL-PEDYPMSAPKVRFI 72
            :..::.|..:.|.|.....||.....||||:.||..|.:|||.|..::.: |.......|:|.|.
 Worm   175 MNRSRHLQGKKVNGCIMRIDETKQLLFHVIIDGPVGSIYEGGTFFADINIQPYQNHSLIPRVCFH 239

  Fly    73 TKIYHPNIDRLGRICLDVLKDKWSPALQI-----------RTILLSIQAL-------LSAPNPDD 119
            |.|:|||:.:.|.  .|:...:|.....:           |.:...|:..       :|.||   
 Worm   240 TFIFHPNLGKYGN--WDMRGIQWERRSNLEVLYNFIVEGMRNVKYDIERRNLAQLEDMSQPN--- 299

  Fly   120 PLANDVAELWKVNEAEAIRNAREWTQKYA 148
                 ::.|.|.:..:..|.|||:..|.|
 Worm   300 -----ISRLAKEDWPKFERTAREFVMKMA 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
benNP_001162752.1 UBCc 3..149 CDD:412187 41/159 (26%)
uev-3NP_001361859.1 PHA03247 <9..73 CDD:223021
UBCc 185..319 CDD:381827 38/143 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.860

Return to query results.
Submit another query.