DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ben and ubc-7

DIOPT Version :9

Sequence 1:NP_001162752.1 Gene:ben / 32358 FlyBaseID:FBgn0000173 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_499133.1 Gene:ubc-7 / 176363 WormBaseID:WBGene00006704 Length:164 Species:Caenorhabditis elegans


Alignment Length:154 Identity:54/154 - (35%)
Similarity:87/154 - (56%) Gaps:21/154 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KETQRLMQEPVPGINA-IPDENNARYFHVIVTGPNDSPFEGGVFKLELFLPEDYPMSAPKVRFIT 73
            |:...:.:.||.|.:| :.|:|:...:.|:|.||.|:.:|||.||..|..|.|||...||::||:
 Worm    10 KQLADMRRVPVDGFSAGLVDDNDIYKWEVLVIGPPDTLYEGGFFKAILDFPRDYPQKPPKMKFIS 74

  Fly    74 KIYHPNIDRLGRICLDVLKD-------------KWSPALQIRTILLSIQALLSAPNPDDPLANDV 125
            :|:|||||:.|.:|:.:|.|             :|.|...:.|||||:.::|:.||.:.|...|.
 Worm    75 EIWHPNIDKEGNVCISILHDPGDDKWGYERPEERWLPVHTVETILLSVISMLTDPNFESPANVDA 139

  Fly   126 AELWKVNEAE-------AIRNARE 142
            |::.:.|.||       .:|.::|
 Worm   140 AKMQRENYAEFKKKVAQCVRRSQE 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
benNP_001162752.1 UBCc 3..149 CDD:412187 54/154 (35%)
ubc-7NP_499133.1 COG5078 8..161 CDD:227410 53/150 (35%)
UQ_con 8..158 CDD:278603 52/147 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.