DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ben and Ube2n

DIOPT Version :9

Sequence 1:NP_001162752.1 Gene:ben / 32358 FlyBaseID:FBgn0000173 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_446380.1 Gene:Ube2n / 116725 RGDID:621096 Length:152 Species:Rattus norvegicus


Alignment Length:151 Identity:121/151 - (80%)
Similarity:137/151 - (90%) Gaps:0/151 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSLPRRIIKETQRLMQEPVPGINAIPDENNARYFHVIVTGPNDSPFEGGVFKLELFLPEDYPMS 65
            |:.||||||||||||:.||||||.|.|||:|||||||::.||.|||||||.|||||||||:|||:
  Rat     1 MAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMA 65

  Fly    66 APKVRFITKIYHPNIDRLGRICLDVLKDKWSPALQIRTILLSIQALLSAPNPDDPLANDVAELWK 130
            ||||||:|||||||:|:|||||||:|||||||||||||:|||||||||||||||||||||||.||
  Rat    66 APKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWK 130

  Fly   131 VNEAEAIRNAREWTQKYAVED 151
            .|||:||..||.||:.||:.:
  Rat   131 SNEAQAIETARAWTRLYAMNN 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
benNP_001162752.1 UBCc 3..149 CDD:412187 119/145 (82%)
Ube2nNP_446380.1 UBCc 4..151 CDD:412187 120/146 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340422
Domainoid 1 1.000 243 1.000 Domainoid score I2143
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 261 1.000 Inparanoid score I3022
OMA 1 1.010 - - QHG53976
OrthoDB 1 1.010 - - D1345547at2759
OrthoFinder 1 1.000 - - FOG0002236
OrthoInspector 1 1.000 - - oto97553
orthoMCL 1 0.900 - - OOG6_101934
Panther 1 1.100 - - LDO PTHR24068
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1478
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.910

Return to query results.
Submit another query.