DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ben and ube2ia

DIOPT Version :9

Sequence 1:NP_001162752.1 Gene:ben / 32358 FlyBaseID:FBgn0000173 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_571908.1 Gene:ube2ia / 114445 ZFINID:ZDB-GENE-010607-1 Length:157 Species:Danio rerio


Alignment Length:149 Identity:50/149 - (33%)
Similarity:81/149 - (54%) Gaps:7/149 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RIIKETQRLMQEPVPGINAIPDEN-----NARYFHVIVTGPNDSPFEGGVFKLELFLPEDYPMSA 66
            |:.:|.:...::...|..|:|.:|     |...:...:.|...:|:|||:|||.:...:|||.|.
Zfish     8 RLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSP 72

  Fly    67 PKVRFITKIYHPNIDRLGRICLDVL-KDK-WSPALQIRTILLSIQALLSAPNPDDPLANDVAELW 129
            ||.:|...::|||:...|.:||.:| :|| |.||:.|:.|||.||.||:.||..||...:...::
Zfish    73 PKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIY 137

  Fly   130 KVNEAEAIRNAREWTQKYA 148
            ..|..|..:..|...:|::
Zfish   138 CQNRVEYEKRVRAQAKKFS 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
benNP_001162752.1 UBCc 3..149 CDD:412187 50/149 (34%)
ube2iaNP_571908.1 UQ_con 8..152 CDD:395127 49/143 (34%)
Interaction with SUMO1. /evidence=ECO:0000250 13..18 0/4 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.