DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ben and LOC103690504

DIOPT Version :9

Sequence 1:NP_001162752.1 Gene:ben / 32358 FlyBaseID:FBgn0000173 Length:151 Species:Drosophila melanogaster
Sequence 2:XP_017452421.2 Gene:LOC103690504 / 103690504 RGDID:9222779 Length:166 Species:Rattus norvegicus


Alignment Length:127 Identity:85/127 - (66%)
Similarity:101/127 - (79%) Gaps:1/127 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSLPRRIIKETQRLMQEPVPGINAIPDENNARYFHVIVTGPNDSPFEGGVFKLELFLPEDYPMS 65
            |..||..|:|||||.:.|.:|.|...|||.||.||||::.||.|.||:|..||||.|| ::|||:
  Rat    40 MVGLPLGIVKETQRWLAESIPDIKEKPDEKNAHYFHVVIAGPQDFPFKGRNFKLEPFL-QEYPMA 103

  Fly    66 APKVRFITKIYHPNIDRLGRICLDVLKDKWSPALQIRTILLSIQALLSAPNPDDPLANDVAE 127
            ||||||:||||||.:|:|||..|.:|||||:|||||||:||.||||||.||||||||||:||
  Rat   104 APKVRFMTKIYHPRVDKLGRKYLVILKDKWTPALQIRTVLLLIQALLSDPNPDDPLANDIAE 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
benNP_001162752.1 UBCc 3..149 CDD:412187 84/125 (67%)
LOC103690504XP_017452421.2 UBCc 47..165 CDD:412187 80/118 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1345547at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.