DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mamo and ZBTB45

DIOPT Version :9

Sequence 1:NP_572932.2 Gene:mamo / 32353 FlyBaseID:FBgn0267033 Length:1553 Species:Drosophila melanogaster
Sequence 2:NP_001303907.1 Gene:ZBTB45 / 84878 HGNCID:23715 Length:511 Species:Homo sapiens


Alignment Length:364 Identity:76/364 - (20%)
Similarity:114/364 - (31%) Gaps:109/364 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly  1188 GSGSGPSSSAISVSVAAPTSV--SASGSVTSVDQDVVTSSQEPM-LADEGEDLRVNVKREGTADE 1249
            |.|.||...      .||.|.  .|:|.:|:...........|. |||.....|..::..|:|::
Human   223 GEGGGPGEG------QAPPSFPDCAAGFLTAAADSACEEPPAPTGLADYSGAGRDFLRGAGSAED 281

  Fly  1250 QSAESRANDLEEHEQDNTVDSAGITMLYQDNNSSASASTSATEPNISSSDGIHSTNKRSRLHHLE 1314
            ...:|..:..  |::|..|             .....:.:..:|:...|.        ||...::
Human   282 VFPDSYVSTW--HDEDGAV-------------PEGCPTETPVQPDCILSG--------SRPPGVK 323

  Fly  1315 TDPSYPHHHHHHHHHHHQQQHHQAQHQHHNPQSQLPTHLGHVSLPLVATSAAGSSSSAAAAAVVA 1379
            |...                          |.:..|.|||....|....||....:.|...|...
Human   324 TPGP--------------------------PVALFPFHLGAPGPPAPPPSAPSGPAPAPPPAFYP 362

  Fly  1380 AAQAQVS-SGATGSGATGSGAPGSGNVGSAGSSGAGGGISSLSSLTSLINAERIPNEQFLGLNPQ 1443
            ..|.:.: |...|.....|.||.:...|:..                                  
Human   363 TLQPEAAPSTQLGEVPAPSAAPTTAPSGTPA---------------------------------- 393

  Fly  1444 EASILNFLRVDAAERQRDKRPATSRFACPFCGKCVRSKENLKLHVRKHTGERPFVCLFCGRAFGG 1508
                    |...||      |.|  :.|..|.|...|::|...|:..|:||:|..|..|.|:|..
Human   394 --------RTPGAE------PPT--YECSHCRKTFSSRKNYTKHMFIHSGEKPHQCAVCWRSFSL 442

  Fly  1509 KSDLTRHLRIHTGERPYHCESCGKCFARADYLSKHLTTH 1547
            :..|.:|:..|||.|.:.|..|.|.|.:...|:.|:.||
Human   443 RDYLLKHMVTHTGVRAFQCAVCAKRFTQKSSLNVHMRTH 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mamoNP_572932.2 BTB 21..118 CDD:279045
BTB 32..118 CDD:197585
C2H2 Zn finger 1082..1105 CDD:275368
C2H2 Zn finger 1116..1137 CDD:275368
C2H2 Zn finger 1149..1169 CDD:275368
zf-C2H2 1469..1491 CDD:278523 6/21 (29%)
C2H2 Zn finger 1471..1491 CDD:275368 6/19 (32%)
zf-H2C2_2 1483..1506 CDD:290200 9/22 (41%)
C2H2 Zn finger 1499..1519 CDD:275368 6/19 (32%)
zf-H2C2_2 1511..1536 CDD:290200 10/24 (42%)
C2H2 Zn finger 1527..1547 CDD:275368 6/19 (32%)
ZBTB45NP_001303907.1 BTB 23..122 CDD:279045
BTB 34..124 CDD:197585
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 159..241 7/23 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 294..403 29/205 (14%)
zf-C2H2 403..425 CDD:278523 6/21 (29%)
COG5048 <405..>472 CDD:227381 24/66 (36%)
C2H2 Zn finger 405..425 CDD:275368 6/19 (32%)
zf-H2C2_2 417..441 CDD:290200 9/23 (39%)
C2H2 Zn finger 433..453 CDD:275368 6/19 (32%)
zf-H2C2_2 445..470 CDD:290200 10/24 (42%)
zf-C2H2 459..481 CDD:278523 6/21 (29%)
C2H2 Zn finger 461..481 CDD:275368 6/19 (32%)
zf-H2C2_2 473..497 CDD:290200 4/9 (44%)
C2H2 Zn finger 488..508 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.