Sequence 1: | NP_572932.2 | Gene: | mamo / 32353 | FlyBaseID: | FBgn0267033 | Length: | 1553 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001034621.1 | Gene: | Zfp784 / 654801 | MGIID: | 3606042 | Length: | 297 | Species: | Mus musculus |
Alignment Length: | 271 | Identity: | 63/271 - (23%) |
---|---|---|---|
Similarity: | 91/271 - (33%) | Gaps: | 96/271 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 1294 NISSSDGIHSTNKRSRLHHLETDPSYPHHHHHHHHHHHQQQHHQA--------------QHQH-H 1343
Fly 1344 NPQSQLPTHLGHVSLPLVATSAAGSSSSAAAAAVVAAAQAQVSSGATGSGATGSGAPGSGNVGSA 1408
Fly 1409 GSSGAGGGISSLSSLTSLINAERIPNEQFLGLNPQEASILNFLRVDAAERQRDKRPATSRFACPF 1473
Fly 1474 CGKCVRSKENLKLHVRKHTGERPFVCLFCGRAFGGKSDLTRHLRIHTGERPYHCESCGKCFARAD 1538
Fly 1539 YLSKHLTTHIH 1549 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
mamo | NP_572932.2 | BTB | 21..118 | CDD:279045 | |
BTB | 32..118 | CDD:197585 | |||
C2H2 Zn finger | 1082..1105 | CDD:275368 | |||
C2H2 Zn finger | 1116..1137 | CDD:275368 | |||
C2H2 Zn finger | 1149..1169 | CDD:275368 | |||
zf-C2H2 | 1469..1491 | CDD:278523 | 9/21 (43%) | ||
C2H2 Zn finger | 1471..1491 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 1483..1506 | CDD:290200 | 11/22 (50%) | ||
C2H2 Zn finger | 1499..1519 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 1511..1536 | CDD:290200 | 13/24 (54%) | ||
C2H2 Zn finger | 1527..1547 | CDD:275368 | 5/19 (26%) | ||
Zfp784 | NP_001034621.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..39 | ||
C2H2 Zn finger | 66..86 | CDD:275368 | 63/271 (23%) | ||
C2H2 Zn finger | 102..122 | CDD:275368 | 3/19 (16%) | ||
zf-H2C2_2 | 114..138 | CDD:290200 | 2/23 (9%) | ||
C2H2 Zn finger | 130..150 | CDD:275368 | 3/19 (16%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 149..175 | 7/37 (19%) | |||
COG5048 | <193..297 | CDD:227381 | 39/151 (26%) | ||
C2H2 Zn finger | 197..217 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 209..234 | CDD:290200 | 12/24 (50%) | ||
C2H2 Zn finger | 225..245 | CDD:275368 | 8/19 (42%) | ||
zf-C2H2 | 251..273 | CDD:278523 | 5/21 (24%) | ||
C2H2 Zn finger | 253..273 | CDD:275368 | 5/19 (26%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 268..297 | 5/8 (63%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S3593 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.950 |