DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mamo and BTBD18

DIOPT Version :9

Sequence 1:NP_572932.2 Gene:mamo / 32353 FlyBaseID:FBgn0267033 Length:1553 Species:Drosophila melanogaster
Sequence 2:NP_001138573.1 Gene:BTBD18 / 643376 HGNCID:37214 Length:712 Species:Homo sapiens


Alignment Length:472 Identity:88/472 - (18%)
Similarity:149/472 - (31%) Gaps:140/472 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 QDGSLVDVTLVCSEGTSIRAHKVVLSACSSYF-QSLFLEHPE--GHLIVILKDVRFAELQTLVEF 87
            |.....|| |:.:||.::.||..:|||||.:| :.|..|.|.  |.:::.|..::.:.|:.||:|
Human    29 QSDVFCDV-LLQAEGEAVPAHCCILSACSPFFTERLERERPAQGGKVVLELGGLKISTLRKLVDF 92

  Fly    88 MYKGEVNVQYCQLSALLKTAESLKVKGLAEMTNQNTTLREPEREPDRLRPQGGGGSGGSAHKAAD 152
            :|..|:.|...:...:|..|..|:|..|..:..:                      ||...||..
Human    93 LYTSEMEVSQEEAQDVLSAARQLRVSELESLQLE----------------------GGKLVKAPQ 135

  Fly   153 SPAAALDATAATQAATATATATAAAATSTSTSATSAAATAAATAATSASTTATAAAGSSNTTTTT 217
            ......:....|.||..:|....                                  .|:...|.
Human   136 GRRLNRECLQPTSAAPISARVVT----------------------------------PSHHPHTP 166

  Fly   218 AATTTATCATAATSTAATSSSSSVTSAAAAAAAAASASGVAHSEEATSSSSSTGGQKREASDRSS 282
            ..|....|...|....:.........               ::.:...:.|.|...||:|  |:.
Human   167 LPTNQTPCPLGAIRLKSLGKEEGPQE---------------NNRQNADNLSGTLLLKRKA--RAC 214

  Fly   283 PTPAKRSSRMHPADKVDVAEDREQEQNQADELLSEELLGRNLKDEEDDDVDELDENEETKLRGRD 347
            |||.:::|  .|:     :..:|..:|:.|..|...:|.                          
Human   215 PTPQEKNS--SPS-----SHSQEPRENKNDTALDPTVLS-------------------------- 246

  Fly   348 EDDDDEDEEEDTPMPLDLYQRPNVE----PKSAAAATAAQQGG------SNSLSGSSNACHTNSS 402
                          |..||  |:|:    |:....:.:....|      |:.|||||:...|...
Human   247 --------------PPSLY--PSVDKHLLPRKIRLSRSKPSPGICTSKPSSILSGSSSVPATPGR 295

  Fly   403 SNSNNNNNNNNNSSSNNNNNTSSGKTSASSNGGTASSGGT--ADSVVAVDDDDDDDDG--GHHHQ 463
            ......:.|............:|...|..:..|...:||:  ....|...:.|..::|  |....
Human   296 RLWRQRSVNKETPEDKPKPGRASPLQSTPNPSGLGKTGGSRKRSPEVRAPNSDSAEEGQVGRVKL 360

  Fly   464 RQVMDDRLEQDVDEEDL 480
            |::::....:.|.|..|
Human   361 RKIVNGTCWEVVQETPL 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mamoNP_572932.2 BTB 21..118 CDD:279045 31/94 (33%)
BTB 32..118 CDD:197585 30/88 (34%)
C2H2 Zn finger 1082..1105 CDD:275368
C2H2 Zn finger 1116..1137 CDD:275368
C2H2 Zn finger 1149..1169 CDD:275368
zf-C2H2 1469..1491 CDD:278523
C2H2 Zn finger 1471..1491 CDD:275368
zf-H2C2_2 1483..1506 CDD:290200
C2H2 Zn finger 1499..1519 CDD:275368
zf-H2C2_2 1511..1536 CDD:290200
C2H2 Zn finger 1527..1547 CDD:275368
BTBD18NP_001138573.1 BTB 24..120 CDD:306997 30/91 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 157..176 4/52 (8%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..355 34/191 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 374..410 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 653..676
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 691..712
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000141
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.