DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mamo and lolal

DIOPT Version :9

Sequence 1:NP_572932.2 Gene:mamo / 32353 FlyBaseID:FBgn0267033 Length:1553 Species:Drosophila melanogaster
Sequence 2:NP_001163186.1 Gene:lolal / 44703 FlyBaseID:FBgn0022238 Length:127 Species:Drosophila melanogaster


Alignment Length:114 Identity:62/114 - (54%)
Similarity:82/114 - (71%) Gaps:1/114 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 EHYCLRWNNYQSNLLGVFSQLLQDGSLVDVTLVCSEGTSIRAHKVVLSACSSYFQSLFLEHPEGH 68
            :.:.|:||::|:|::..|..|..:.|..||||.| ||.:.:|||:||||||.||::|..|:|..|
  Fly     6 QQFFLKWNDFQTNMVTSFRHLRDEKSFTDVTLAC-EGQTCKAHKMVLSACSPYFKALLEENPSKH 69

  Fly    69 LIVILKDVRFAELQTLVEFMYKGEVNVQYCQLSALLKTAESLKVKGLAE 117
            .|:|||||.:..||.::||||.|||||...||.|.||||:.||||||||
  Fly    70 PIIILKDVSYIHLQAILEFMYAGEVNVSQEQLPAFLKTADRLKVKGLAE 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mamoNP_572932.2 BTB 21..118 CDD:279045 57/97 (59%)
BTB 32..118 CDD:197585 54/86 (63%)
C2H2 Zn finger 1082..1105 CDD:275368
C2H2 Zn finger 1116..1137 CDD:275368
C2H2 Zn finger 1149..1169 CDD:275368
zf-C2H2 1469..1491 CDD:278523
C2H2 Zn finger 1471..1491 CDD:275368
zf-H2C2_2 1483..1506 CDD:290200
C2H2 Zn finger 1499..1519 CDD:275368
zf-H2C2_2 1511..1536 CDD:290200
C2H2 Zn finger 1527..1547 CDD:275368
lolalNP_001163186.1 BTB_POZ_BAB-like 32..115 CDD:349624 49/83 (59%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451882
Domainoid 1 1.000 59 1.000 Domainoid score I10615
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000141
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.