DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mamo and ZNF784

DIOPT Version :9

Sequence 1:NP_572932.2 Gene:mamo / 32353 FlyBaseID:FBgn0267033 Length:1553 Species:Drosophila melanogaster
Sequence 2:NP_976308.1 Gene:ZNF784 / 147808 HGNCID:33111 Length:323 Species:Homo sapiens


Alignment Length:195 Identity:60/195 - (30%)
Similarity:77/195 - (39%) Gaps:49/195 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly  1397 SGAPGSGNVGSAGSSGAGG----GISSLSSLTSLINAER------IPN----------------- 1434
            :||.|.|..|........|    |.:||.:..||...||      .|.                 
Human    89 AGAEGGGQGGDPSRCHVCGHSCPGPASLRAHYSLHTGERPYRCALCPRAFKALAPLLRHQHRHGV 153

  Fly  1435 ---------------EQFLGLNPQEASILNFLRVDAAERQRDKRPATSRFACPFCGKCVRSKENL 1484
                           ||..|:.|:.|.:   :...||......:|    |||.||.|..|...::
Human   154 EPGTSRRPPDTAAVAEQRPGVAPERAEV---VMAAAAAGAAVGKP----FACRFCAKPFRRSSDM 211

  Fly  1485 KLHVRKHTGERPFVCLFCGRAFGGKSDLTRHLRIHTGERPYHCESCGKCFARADYLSKHLTTHIH 1549
            :.|.|.||||||:.|..||:.|...|.|:.|.||||||||:.|..|.:.|..:....||..||.|
Human   212 RDHERVHTGERPYHCGICGKGFTQSSVLSGHARIHTGERPFRCTLCDRTFNNSSNFRKHQRTHFH 276

  Fly  1550  1549
            Human   277  276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mamoNP_572932.2 BTB 21..118 CDD:279045
BTB 32..118 CDD:197585
C2H2 Zn finger 1082..1105 CDD:275368
C2H2 Zn finger 1116..1137 CDD:275368
C2H2 Zn finger 1149..1169 CDD:275368
zf-C2H2 1469..1491 CDD:278523 9/21 (43%)
C2H2 Zn finger 1471..1491 CDD:275368 7/19 (37%)
zf-H2C2_2 1483..1506 CDD:290200 11/22 (50%)
C2H2 Zn finger 1499..1519 CDD:275368 8/19 (42%)
zf-H2C2_2 1511..1536 CDD:290200 13/24 (54%)
C2H2 Zn finger 1527..1547 CDD:275368 5/19 (26%)
ZNF784NP_976308.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
C2H2 Zn finger 67..87 CDD:275368
C2H2 Zn finger 103..123 CDD:275368 5/19 (26%)
C2H2 Zn finger 131..151 CDD:275368 1/19 (5%)
COG5048 <194..276 CDD:227381 38/85 (45%)
C2H2 Zn finger 198..218 CDD:275368 7/19 (37%)
C2H2 Zn finger 226..246 CDD:275368 8/19 (42%)
C2H2 Zn finger 254..274 CDD:275368 5/19 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 269..323 5/8 (63%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3593
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.