DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AMPdeam and AAH1

DIOPT Version :9

Sequence 1:NP_001285233.1 Gene:AMPdeam / 32352 FlyBaseID:FBgn0052626 Length:798 Species:Drosophila melanogaster
Sequence 2:NP_014258.1 Gene:AAH1 / 855581 SGDID:S000005085 Length:347 Species:Saccharomyces cerevisiae


Alignment Length:385 Identity:86/385 - (22%)
Similarity:129/385 - (33%) Gaps:118/385 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   431 LREVFLKTDNYLNGKYFAQIIKEVAFDLEESKYQNAELRLSIY--GK----SPDEWYKLAKWAID 489
            |.|.|.|:...||.||              .|:::.:..|..|  |.    |..:::.|| ||..
Yeast    39 LPEGFPKSVEELNEKY--------------KKFRDLQDFLDYYYIGTNVLISEQDFFDLA-WAYF 88

  Fly   490 NDVYSSNIRWLIQIPRLFDI-------FKSNKMMKSFQEILNNIFLPLFEATAR----PSKHPEL 543
            ..|:...   |:.....:|.       .....:.|.||...:..|.. |..|::    ..:|.|.
Yeast    89 KKVHKQG---LVHAEVFYDPQSHTSRGISIETVTKGFQRACDKAFSE-FGITSKLIMCLLRHIEP 149

  Fly   544 HRFLQYV--------------IGFDSVDDESKPENPLFDNDVPRPEEWTYEENPPYAYYIYYMYA 594
            ...|:.:              :|.||.      |.|.                ||:.:  ...|.
Yeast   150 EECLKTIEEATPFIKDGTISALGLDSA------EKPF----------------PPHLF--VECYG 190

  Fly   595 NMTVLNKFRQSRNMNTFVLRPHCGEAGPVQHL--VCGFLMAENISHGLLLRKVPVLQYLYYLTQI 657
            ....|||        ...|..|.||.||.|.:  ....|....|.||:..:....|.......|.
Yeast   191 KAASLNK--------DLKLTAHAGEEGPAQFVSDALDLLQVTRIDHGINSQYDEELLDRLSRDQT 247

  Fly   658 GIAMSPLSNNSLFL--NYHRNPLPEYLARGLIISLSTDDPLQFHFTKEPLMEEYSIAAQVWKLSS 720
            .:.:.||||..|.:  :....||.::|.|.:..||::|||..|   ...:::.|:   ||.|   
Yeast   248 MLTICPLSNVKLQVVQSVSELPLQKFLDRDVPFSLNSDDPAYF---GGYILDVYT---QVSK--- 303

  Fly   721 CDMCELARNSVMMSGFPHAIKQQWLGPIYYEDGIMGN--DITRTN-----VPEIRVAYRY 773
                          .|||...:.| |.| .::.|.|:  |..|.|     |.|:...|.:
Yeast   304 --------------DFPHWDHETW-GRI-AKNAIKGSWCDDKRKNGLLSRVDEVVTKYSH 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AMPdeamNP_001285233.1 PLN03055 248..784 CDD:178613 86/385 (22%)
AMPD 284..780 CDD:238644 86/385 (22%)
AAH1NP_014258.1 aden_deam 10..338 CDD:273619 83/374 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.