DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AMPdeam and Adgf-C

DIOPT Version :9

Sequence 1:NP_001285233.1 Gene:AMPdeam / 32352 FlyBaseID:FBgn0052626 Length:798 Species:Drosophila melanogaster
Sequence 2:NP_650308.3 Gene:Adgf-C / 41680 FlyBaseID:FBgn0038173 Length:506 Species:Drosophila melanogaster


Alignment Length:437 Identity:88/437 - (20%)
Similarity:159/437 - (36%) Gaps:127/437 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   323 ELRELAAQKAVPHRDFYNTRKVDTHIH---AASCMNQKHLLRFIKKTLKNNANEVVTVTNGQQMT 384
            :|.|||       :.|.|..:....:|   |...:::..:.||::|..|.:   |:.|.|...::
  Fly    62 KLGELA-------QGFRNAEQNAAALHFFKAKPLIDRSAIFRFLQKMPKGS---VLHVHNTASVS 116

  Fly   385 LAQVFQSMN-------LTT---------------------YDLTVDMLDVHADRNTFHR-FDKFN 420
            ...|...::       .||                     |.|..|......||..:.| |::..
  Fly   117 SKWVVDDLSYMPGLLRCTTATGQSILSFRRTPKEHKCQSQYVLVSDERRNSLDRQVYDRNFERLI 181

  Fly   421 SKYNPIGE----------SRLREVFLKTDNYLNGKYFAQIIKEVAFDLEESKYQN----AELRLS 471
            :.|.|:.|          .|.:.:|   |...:...:....:...:.:.|..|.:    .|:|.|
  Fly   182 NLYTPVPELEYPTITRVWDRFQGMF---DGLSDALIYLPAFRAYHWQMLEELYNDNVMYTEIRTS 243

  Fly   472 ---IYGKS----PDEWYKLAKWAIDNDVYSSNIRWLIQIPR------LFDIFKSNKM--MKSFQE 521
               :|..|    |.|       ...:::|:.|.:::...|.      :..:::..::  :|...|
  Fly   244 FKTLYDASGRTFPRE-------RTIHELYALNQKFMKLHPDFLGFKVIMAVYRGYELDHLKDIVE 301

  Fly   522 ILNNIFLPLFEATARPSKHPELHRFLQYVIGFDSVDDESKPENPLFDNDVPRPEEWTYEENPPYA 586
            :...:             |..|..||   :|||.|..|.|.: ||: :.:|     ...:.||.|
  Fly   302 VFKKL-------------HQALPHFL---VGFDLVGQEDKGK-PLY-SLLP-----VLRDLPPTA 343

  Fly   587 YYIYYMYANMTVLNKFRQSRNMNTFVLRPHCGEAGPVQHLVCGFLM-AENISHGLLLRKVPVLQY 650
            .  .:::...|  |.|..|.::|                |:...|| ...|.||..|.|.|:|..
  Fly   344 R--LFLHGGET--NWFGASTDIN----------------LLDALLMNTTRIGHGYALAKHPILLN 388

  Fly   651 LYYLTQIGIAMSPLSNNSLFL--NYHRNPLPEYLARGLIISLSTDDP 695
            .....:|.:.:||:||..|.|  :...:|..::.|..:.:.:..|||
  Fly   389 AVKSRRIAVELSPISNQVLHLVWDLRNHPGSQFFALDVPVVICNDDP 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AMPdeamNP_001285233.1 PLN03055 248..784 CDD:178613 88/437 (20%)
AMPD 284..780 CDD:238644 88/437 (20%)
Adgf-CNP_650308.3 A_deaminase_N 5..98 CDD:285627 9/42 (21%)
adm_rel 25..501 CDD:273620 88/437 (20%)
ADGF 78..493 CDD:238646 82/414 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1816
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.