DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AMPdeam and Adgf-D

DIOPT Version :9

Sequence 1:NP_001285233.1 Gene:AMPdeam / 32352 FlyBaseID:FBgn0052626 Length:798 Species:Drosophila melanogaster
Sequence 2:NP_524345.2 Gene:Adgf-D / 41679 FlyBaseID:FBgn0038172 Length:502 Species:Drosophila melanogaster


Alignment Length:509 Identity:111/509 - (21%)
Similarity:175/509 - (34%) Gaps:174/509 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   310 YLSSKYQM--HVLLNELR-ELA-----AQKAVPHRDFYNTRKVDTHIHAASCMNQKHLLRFIKKT 366
            :|||..:.  .:|:|..| |:|     .:|..|...|:..|:.         :.|..:.|.|:|.
  Fly    48 WLSSDEEKANSILMNAKRAEIAEGLKTPEKYAPAMHFFQGRQY---------VRQSEVFRMIQKI 103

  Fly   367 LKNNANEVVTVTNGQQMTLAQVFQSMNLTTYD-------------LTVDMLDVHA---------- 408
            .|   ...:...|...:|...:.|  ||||.:             .|.|....|:          
  Fly   104 PK---GAFLHGHNTGMVTSRWIIQ--NLTTTNNLYTCRNVDGLLVFTYDQSGCHSEVQNVCTERI 163

  Fly   409 ---DRNTFHR-FDKFNSKYNPIGES----------RLREVFLKTDNYLNGKY---FAQIIKEVAF 456
               ||..:.| .:|..:.:.|..|:          |...:|...|...  ||   :....|.:..
  Fly   164 NAEDRGKYERQLEKHINMHGPRPEALLPNRKKIWERFENIFTTVDRLY--KYRPTYCAYHKRMLE 226

  Fly   457 DLEESKYQNAELRLSIYGKSPDEWYKLAKWAIDNDVYSSNIRWLI------QIPRLFDIFK---- 511
            :|.|.....||:|.|:   ||              :|..|.|.|.      ::.|:.:.||    
  Fly   227 ELCEDNIIYAEIRASL---SP--------------LYDDNNRTLSTLEVANELERIVEEFKAKHH 274

  Fly   512 ---------SNKMMKSFQEILNNI--FLPLFEATARPSKHPELHRFLQYVIGFDSV--DDESKPE 563
                     :.:...|.:|:|..|  |..|..  |:|:          :|||||.:  :|..:|.
  Fly   275 DFIGVKVIYAKRNRASEEEMLRRITTFKQLHH--AKPN----------FVIGFDLIGQEDTGEPL 327

  Fly   564 NPLFD--NDVPRPEEWTYEENPPYAYYIYYMYANMTVLNKFRQSRNMNTFVLRPHCGEAGPVQHL 626
            |...:  :|:|....             |:.:|..|..|. |...||...:|             
  Fly   328 NRYINQLSDLPSTAN-------------YFFHAGETNWNG-RTDWNMMDAIL------------- 365

  Fly   627 VCGFLMAENISHGLLLRKVPVLQYLYYLTQIGIAMSPLSNNSL-FL-NYHRNPLPEYLARGLIIS 689
                |..:.|.|...|.|.|.|........|.|.::|:||..| |: :...:|....:|....|.
  Fly   366 ----LNTKRIGHAFALPKHPQLWSTIKKRNIAIEVNPISNQVLGFVWDLRNHPASFLIAENFPIV 426

  Fly   690 LSTDDP-------LQFHFTKEPLMEEYSIAAQVWKLSSCD-----MCELARNSV 731
            :|:|||       |.:.|       .|:..|    |:..|     :.:||.||:
  Fly   427 ISSDDPGVWGAKGLSYDF-------YYAFMA----LAPADADLRFLKQLALNSI 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AMPdeamNP_001285233.1 PLN03055 248..784 CDD:178613 111/509 (22%)
AMPD 284..780 CDD:238644 111/509 (22%)
Adgf-DNP_524345.2 A_deaminase_N 4..100 CDD:285627 14/60 (23%)
adm_rel 27..498 CDD:273620 111/509 (22%)
ADGF 80..490 CDD:238646 102/477 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1816
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.