DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AMPdeam and Adgf-E

DIOPT Version :9

Sequence 1:NP_001285233.1 Gene:AMPdeam / 32352 FlyBaseID:FBgn0052626 Length:798 Species:Drosophila melanogaster
Sequence 2:NP_610977.1 Gene:Adgf-E / 36627 FlyBaseID:FBgn0033952 Length:539 Species:Drosophila melanogaster


Alignment Length:577 Identity:119/577 - (20%)
Similarity:217/577 - (37%) Gaps:147/577 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 LRHSPMKIT-----NPWNVEFPNDEDFKIKPLNGVFHIYEN-DDESSEIKYEYPDMSQFVNDMQV 290
            :.|:|.|:|     ...|:.....:|::|  |..:|:.:|. ....::|:...|:.:  .|:: :
  Fly    26 IHHNPEKMTLLEMLGTTNLRKSTPKDYRI--LREIFNSFERYSGVGNDIQLTLPERA--ANEL-I 85

  Fly   291 MCNM-------IADGPLKSFCYRRLCYLSSKYQMHVLLNELREL---AAQKA------------- 332
            ||..       |.| |.|......:..:.:|.:...|...||.:   ||.||             
  Fly    86 MCEKKREYEKGIMD-PSKFAPGHHIFQVLTKVKKSPLFQILRRMPKGAALKAHDTSMCSSRVVIE 149

  Fly   333 VPHRDFYNTRKVDTHIHAASCMN--QKHLLRFIKKTLKNNANEVVTVTNGQQMTLAQV------- 388
            :.:||         ::...:..|  :....||.|...|:     |:..||:...:.::       
  Fly   150 ITYRD---------NLWVCTTQNGCRVEEFRFAKDKPKD-----VSFENGEWQPMEKLRELRGEE 200

  Fly   389 ----FQSMNLTTYDLTVDMLDVHADRNTFHRFDKFNS--KYNPI-GE---SRLREVFLKTDNYLN 443
                :..|..:.|.|.....:.||.|:....|...:.  :|.|: |:   :.|:|.:.....||.
  Fly   201 NLRKYLQMRFSMYPLASFTTNAHAWRHMMGIFGLLDGLLQYAPVWGDYYYNALKEFYADGVQYLE 265

  Fly   444 GKYFAQIIKEVAFDLEESKYQNAELRLSIYGKSPDEWYKLAKWAIDNDVYSSNIRWLIQIPRLFD 508
            .:   .::.:: :.|:.|:....| .:.||..:.:.:.|.....||:.:..:.||. :| |.|. 
  Fly   266 VR---SVLPQL-YSLDGSRMPKRE-TVQIYKDTLERFKKEHPGFIDSKLIYAPIRH-VQ-PELV- 322

  Fly   509 IFKSNKMMKSFQEILNNIFLPLFEATARPSKHPELHRFLQYVIGFDSVDDESKPENPLFDNDVPR 573
                .:.:|...| ||..|         ||          :|:|||.|..|          ||..
  Fly   323 ----GEYIKECTE-LNKEF---------PS----------FVVGFDLVGQE----------DVGH 353

  Fly   574 P-EEWTYE--ENPPYAYYIYYMYANMTVLNKFRQSRNMNTFVLRPHCGEAGPVQHLVCGFLMAEN 635
            | ..:..|  :.|.:.:  :|.:|..|  |.:....:.|.            :..:|.|   .:.
  Fly   354 PLSNFAAELLKLPDHIH--FYFHAGQT--NWYGSHVDQNL------------LDAIVLG---TKR 399

  Fly   636 ISHGLLLRKVPVLQYLYYLTQIGIAMSPLSNNSLFL--NYHRNPLPEYLARGLIISLSTDDPLQF 698
            |.||..:.|.|||..|.....|.:.:.|:||..|.|  :|..:|....:|..:.:.:::..|  .
  Fly   400 IGHGYTITKHPVLMRLAKYLNIALEVCPVSNQVLQLGSDYRSHPAATLIAENVPMVIASGSP--G 462

  Fly   699 HFTKEPLMEEYSIAAQVWKLSSCDMCEL---ARNSVMMSGFPHAI--------KQQW 744
            .:...||..::.:|.......:.|:..|   |:||:..|......        |:||
  Fly   463 FWRAAPLSHDFYMAFLGIAPMNADLKFLKRTAKNSIKYSSLKDEAKAEAMEKWKKQW 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AMPdeamNP_001285233.1 PLN03055 248..784 CDD:178613 114/556 (21%)
AMPD 284..780 CDD:238644 107/519 (21%)
Adgf-ENP_610977.1 A_deaminase_N 46..125 CDD:285627 16/84 (19%)
adm_rel 52..527 CDD:273620 113/551 (21%)
ADGF 105..519 CDD:238646 98/490 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1816
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.