DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AMPdeam and Ada

DIOPT Version :9

Sequence 1:NP_001285233.1 Gene:AMPdeam / 32352 FlyBaseID:FBgn0052626 Length:798 Species:Drosophila melanogaster
Sequence 2:NP_001258981.1 Gene:Ada / 11486 MGIID:87916 Length:352 Species:Mus musculus


Alignment Length:465 Identity:85/465 - (18%)
Similarity:139/465 - (29%) Gaps:173/465 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   339 YNTRKVDTHIHAASCMNQKHLLRFIKKTLKNNANEVVTVTNGQQMTLAQVFQSMNLTTYDLTVDM 403
            :|..||:.|:|....:..:.:|.|.||             .|..:....|.:..|:...|..:.:
Mouse     7 FNKPKVELHVHLDGAIKPETILYFGKK-------------RGIALPADTVEELRNIIGMDKPLSL 58

  Fly   404 LDVHADRNTFHRFDKFNSKYNPIGESRLREVFLKTDNYLNGKYFAQIIKEVAFDLEESKYQN--- 465
            ....|      :||    .|.|: .:..||.                ||.:|::..|.|.:.   
Mouse    59 PGFLA------KFD----YYMPV-IAGCREA----------------IKRIAYEFVEMKAKEGVV 96

  Fly   466 -AELRLSIY-----------------GKSPDEWYKLAKWAIDNDVYSSNIR-------------W 499
             .|:|.|.:                 ..:||:...|....:.....:..|:             |
Mouse    97 YVEVRYSPHLLANSKVDPMPWNQTEGDVTPDDVVDLVNQGLQEGEQAFGIKVRSILCCMRHQPSW 161

  Fly   500 LIQIPRLFDIFKSNKMMKSFQEILNNIFLPLFEATARPSKHPELHRFLQYVIGFDSVDDESKPEN 564
            .:::..|         .|.:.:                          :.|:..|...||:...:
Mouse   162 SLEVLEL---------CKKYNQ--------------------------KTVVAMDLAGDETIEGS 191

  Fly   565 PLFDNDVPRPEEWTYEENPPYAYYIYYMYANMTVLNKFRQSRNMNTFVLRPHCGEAG--PVQHLV 627
            .||...|.     .||.               .|.|...::         .|.||.|  .|....
Mouse   192 SLFPGHVE-----AYEG---------------AVKNGIHRT---------VHAGEVGSPEVVREA 227

  Fly   628 CGFLMAENISHGL-----------LLRK---VPVLQYLYYLTQIGIAMSPLSNNSL--FLNYHRN 676
            ...|..|.:.||.           ||::   ..|..:..|||.   |..|.:.:::  |.|...|
Mouse   228 VDILKTERVGHGYHTIEDEALYNRLLKENMHFEVCPWSSYLTG---AWDPKTTHAVVRFKNDKAN 289

  Fly   677 PLPEYLARGLIISLSTDDPLQFHFTKEPLMEEYSIAAQVWKLSSCDMCELARNSVMMSGFPHAIK 741
                       .||:|||||.|   |..|..:|.:..:....:..:...|..|:...|..|...|
Mouse   290 -----------YSLNTDDPLIF---KSTLDTDYQMTKKDMGFTEEEFKRLNINAAKSSFLPEEEK 340

  Fly   742 QQWLGPIYYE 751
            ::.|..:|.|
Mouse   341 KELLERLYRE 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AMPdeamNP_001285233.1 PLN03055 248..784 CDD:178613 85/465 (18%)
AMPD 284..780 CDD:238644 85/465 (18%)
AdaNP_001258981.1 ADA 8..336 CDD:238645 80/448 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.