DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AMPdeam and ADA

DIOPT Version :9

Sequence 1:NP_001285233.1 Gene:AMPdeam / 32352 FlyBaseID:FBgn0052626 Length:798 Species:Drosophila melanogaster
Sequence 2:NP_000013.2 Gene:ADA / 100 HGNCID:186 Length:363 Species:Homo sapiens


Alignment Length:223 Identity:48/223 - (21%)
Similarity:75/223 - (33%) Gaps:60/223 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   548 QYVIGFDSVDDESKPENPLFDNDVPRPEEWTYEENPPYAYYIYYMYANMTVLNKFRQSRNMNTFV 612
            |.|:..|...||:.|.:.|....|.     .|:|......:       .||              
Human   175 QTVVAIDLAGDETIPGSSLLPGHVQ-----AYQEAVKSGIH-------RTV-------------- 213

  Fly   613 LRPHCGEAGPVQHL--VCGFLMAENISHGL----------LLRK----VPVLQYLYYLTQIGIAM 661
               |.||.|..:.:  ....|..|.:.||.          .||:    ..:..:..|||.   |.
Human   214 ---HAGEVGSAEVVKEAVDILKTERLGHGYHTLEDQALYNRLRQENMHFEICPWSSYLTG---AW 272

  Fly   662 SPLSNNSLFLNYHRNPLPEYLARGLIISLSTDDPLQFHFTKEPLMEEYSIAAQVWKLSSCDMCEL 726
            .|.:.:::.  ..:|....|       ||:|||||.|   |..|..:|.:..:....:..:...|
Human   273 KPDTEHAVI--RLKNDQANY-------SLNTDDPLIF---KSTLDTDYQMTKRDMGFTEEEFKRL 325

  Fly   727 ARNSVMMSGFPHAIKQQWLGPIYYEDGI 754
            ..|:...|..|...|::.|..:|...|:
Human   326 NINAAKSSFLPEDEKRELLDLLYKAYGM 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AMPdeamNP_001285233.1 PLN03055 248..784 CDD:178613 48/223 (22%)
AMPD 284..780 CDD:238644 48/223 (22%)
ADANP_000013.2 metallo-dependent_hydrolases 9..347 CDD:320877 46/215 (21%)
Required for binding to DDP4. /evidence=ECO:0000269|PubMed:15016824 126..143
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.