DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jub and LIMS3

DIOPT Version :9

Sequence 1:NP_572930.3 Gene:jub / 32351 FlyBaseID:FBgn0030530 Length:728 Species:Drosophila melanogaster
Sequence 2:NP_001381830.1 Gene:LIMS3 / 96626 HGNCID:30047 Length:398 Species:Homo sapiens


Alignment Length:320 Identity:79/320 - (24%)
Similarity:122/320 - (38%) Gaps:106/320 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   472 LLPYSVTPPR-------PAGPTEAQRKIEELTRQLEEEIEQSEEHGEYFG--------ICHTCGE 521
            ::|.:...||       .|..||.:|.:.:|.|: ..:::..:|..:::.        ...|| |
Human    11 IIPENEEIPRAALNTVHEANGTEDERAVSKLQRR-HSDVKVYKEFCDFYAKFNMANALASATC-E 73

  Fly   522 KVKG----AGQACQAMGNLYHTNCFICCSCGRALRGKAFYNVHGRVYCEEDYMYSGFQQT-AEKC 581
            :.||    |.....:.|.|||..||:|..|.:......||...||.|||.|     ||.. |..|
Human    74 RCKGGFAPAETIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHD-----FQMLFAPCC 133

  Fly   582 AICGHLIMEMILQAMGKSYHPGCFRCCVCNECLDGVPFTVDV----------------------- 623
            ..||..|:..:::||..|:||.||||.:|.|.|..:.|..:.                       
Human   134 HQCGEFIIGRVIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGRHLCRPCHNREKARGLGKYICQ 198

  Fly   624 --------------------DH-------------------KIYCVNDYHRMFAPKCASCGKGIT 649
                                ||                   ::||:..:.:|..|.|.:|.:   
Human   199 KCHAIIDEQPLIFKNDPYHPDHFNCANCGKDLTADAQELKGELYCLPCHDKMGVPICGACRR--- 260

  Fly   650 PVEGTDETVRVV-SMDKDFHVDCYICEECGMQLTDEP--DKRCYPLDGRLLCRGCHLQRL 706
            |:||     ||| :|.|.:||:.::|.:|     ::|  ..|.|...|...|. .|..:|
Human   261 PIEG-----RVVNAMGKQWHVEHFVCAKC-----EKPFLGHRHYERKGLAYCE-THYNQL 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jubNP_572930.3 LIM1_Ajuba_like 516..569 CDD:188738 21/56 (38%)
LIM2_Ajuba_like 581..633 CDD:188741 21/113 (19%)
LIM3_Ajuba_like 641..702 CDD:188822 19/63 (30%)
LIMS3NP_001381830.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.