DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jub and FHL5

DIOPT Version :9

Sequence 1:NP_572930.3 Gene:jub / 32351 FlyBaseID:FBgn0030530 Length:728 Species:Drosophila melanogaster
Sequence 2:NP_001164278.1 Gene:FHL5 / 9457 HGNCID:17371 Length:284 Species:Homo sapiens


Alignment Length:190 Identity:44/190 - (23%)
Similarity:78/190 - (41%) Gaps:19/190 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   516 CHTCGEKVKGAGQACQAMGNLYHTNCFICCSCGRALRGKAFYNVHGRVYC----EEDYMYSGFQQ 576
            |..|...:....:..:..||.:|..||:|.:|.:.:..|...:.....||    |:::       
Human   102 CFHCKRTIMPGSRKMEFKGNYWHETCFVCENCRQPIGTKPLISKESGNYCVPCFEKEF------- 159

  Fly   577 TAEKCAICGHLIMEMILQAMGKSYHPGCFRCCVCNECLDGVPFTVDVDHKIYCVNDYHRMFAPKC 641
             |..|..|..:|....:....:.:|..||.|..|.:.|....|....|:. :||:.|:.::|.||
Human   160 -AHYCNFCKKVITSGGITFCDQLWHKECFLCSGCRKDLCEEQFMSRDDYP-FCVDCYNHLYANKC 222

  Fly   642 ASCGKGITPVEGTDETVRVVSMDKDFHVDCYICEECGMQLTDEPDKRCYPLDGRLLCRGC 701
            .:|.|   |:.|......:...|..:|.:|:.|.:|.:.|.   .|.....:..:.|:.|
Human   223 VACSK---PISGLTGAKFICFQDSQWHSECFNCGKCSVSLV---GKGFLTQNKEIFCQKC 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jubNP_572930.3 LIM1_Ajuba_like 516..569 CDD:188738 13/56 (23%)
LIM2_Ajuba_like 581..633 CDD:188741 13/51 (25%)
LIM3_Ajuba_like 641..702 CDD:188822 14/61 (23%)
FHL5NP_001164278.1 LIM <5..34 CDD:351770
LIM1_FHL 37..95 CDD:188729
LIM2_FHL5 102..155 CDD:188812 12/52 (23%)
LIM3_FHL 163..214 CDD:188732 13/51 (25%)
LIM4_FHL 222..277 CDD:188733 14/61 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.