DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jub and RGA1

DIOPT Version :9

Sequence 1:NP_572930.3 Gene:jub / 32351 FlyBaseID:FBgn0030530 Length:728 Species:Drosophila melanogaster
Sequence 2:NP_014770.1 Gene:RGA1 / 854294 SGDID:S000005653 Length:1007 Species:Saccharomyces cerevisiae


Alignment Length:137 Identity:33/137 - (24%)
Similarity:60/137 - (43%) Gaps:21/137 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   511 EYFGICHTCGEKVKGAGQACQAMGNLYHTNCFICCSCGRALRGKAFYNVHGRVYCEEDYMYSGFQ 575
            |.|..|..|.|.:. .|.|.:...:.:||:||.|..|.:.|.            ||.|::..|..
Yeast     8 EQFPSCVRCKEFIT-TGHAYELGCDRWHTHCFACYKCEKPLS------------CESDFLVLGTG 59

  Fly   576 -----QTAEKCAICGHLI--MEMILQAMGKSYHPGCFRCCVCNECLDGVPFTVDVDHKIYCVNDY 633
                 ..::.|..||..|  :.:||.:..::|...||:||.|.|.:..:.: ......::|::.:
Yeast    60 ALICFDCSDSCKNCGKKIDDLAIILSSSNEAYCSDCFKCCKCGENIADLRY-AKTKRGLFCLSCH 123

  Fly   634 HRMFAPK 640
            .::.|.:
Yeast   124 EKLLAKR 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jubNP_572930.3 LIM1_Ajuba_like 516..569 CDD:188738 14/52 (27%)
LIM2_Ajuba_like 581..633 CDD:188741 14/53 (26%)
LIM3_Ajuba_like 641..702 CDD:188822 33/137 (24%)
RGA1NP_014770.1 LIM1_Rga 13..67 CDD:188780 16/66 (24%)
LIM2_Rga 70..123 CDD:188781 14/53 (26%)
Smc <569..>673 CDD:224117
RhoGAP 803..1002 CDD:214618
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.