DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jub and WLIM1

DIOPT Version :9

Sequence 1:NP_572930.3 Gene:jub / 32351 FlyBaseID:FBgn0030530 Length:728 Species:Drosophila melanogaster
Sequence 2:NP_172491.1 Gene:WLIM1 / 837558 AraportID:AT1G10200 Length:190 Species:Arabidopsis thaliana


Alignment Length:183 Identity:38/183 - (20%)
Similarity:59/183 - (32%) Gaps:73/183 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   574 FQQTAEKCAICG---HLIMEMILQAMGKSYHPGCFRCCVCNECL--------DGVPFTVDVDHKI 627
            |..|.:||..|.   :|:.:  |.|..:.||..||||..|...|        :||         :
plant     3 FAGTTQKCMACDKTVYLVDK--LTADNRVYHKACFRCHHCKGTLKLSNYNSFEGV---------L 56

  Fly   628 YCVNDYHRMF----------------------------------------APKCASCGKGITPVE 652
            ||...:.:.|                                        ..||..|.|.:.|:|
plant    57 YCRPHFDQNFKRTGSLEKSFEGTPKIGKPDRPLEGERPAGTKVSNMFGGTREKCVGCDKTVYPIE 121

  Fly   653 GTDETVRVVSMDKD-FHVDCYICEECGMQLTDEPDKRCYPLDGRLLCRGCHLQ 704
                   .||::.. :|..|:.|...|..::   .......:|:|.|:..|:|
plant   122 -------KVSVNGTLYHKSCFKCTHGGCTIS---PSNYIAHEGKLYCKHHHIQ 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jubNP_572930.3 LIM1_Ajuba_like 516..569 CDD:188738
LIM2_Ajuba_like 581..633 CDD:188741 17/62 (27%)
LIM3_Ajuba_like 641..702 CDD:188822 14/61 (23%)
WLIM1NP_172491.1 LIM1_SF3 6..68 CDD:188824 20/72 (28%)
LIM2_SF3 110..170 CDD:188825 16/65 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.