DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jub and limd1a

DIOPT Version :9

Sequence 1:NP_572930.3 Gene:jub / 32351 FlyBaseID:FBgn0030530 Length:728 Species:Drosophila melanogaster
Sequence 2:XP_021322480.1 Gene:limd1a / 562793 ZFINID:ZDB-GENE-070712-1 Length:187 Species:Danio rerio


Alignment Length:184 Identity:123/184 - (66%)
Similarity:153/184 - (83%) Gaps:0/184 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   533 MGNLYHTNCFICCSCGRALRGKAFYNVHGRVYCEEDYMYSGFQQTAEKCAICGHLIMEMILQAMG 597
            ||:|||.:||.|.:|.|.|||||||.|.|:|:||||::||||||:|:||::||||||:|||||:|
Zfish     1 MGSLYHDSCFTCSACSRKLRGKAFYFVCGKVFCEEDFLYSGFQQSADKCSVCGHLIMDMILQALG 65

  Fly   598 KSYHPGCFRCCVCNECLDGVPFTVDVDHKIYCVNDYHRMFAPKCASCGKGITPVEGTDETVRVVS 662
            ||||||||||.:|||.|||||||||.::|||||.||||:.|||||:|.:.|.|.||:|||:||||
Zfish    66 KSYHPGCFRCAICNESLDGVPFTVDTENKIYCVKDYHRVLAPKCAACNQPILPSEGSDETIRVVS 130

  Fly   663 MDKDFHVDCYICEECGMQLTDEPDKRCYPLDGRLLCRGCHLQRLALQSSPHARH 716
            ||:|:||:||.||:|.|:|.||...|||||||.|||..|||:.:..||:.:..|
Zfish   131 MDRDYHVECYHCEDCQMELNDEEGHRCYPLDGHLLCHACHLKHIDPQSTANNFH 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jubNP_572930.3 LIM1_Ajuba_like 516..569 CDD:188738 23/35 (66%)
LIM2_Ajuba_like 581..633 CDD:188741 40/51 (78%)
LIM3_Ajuba_like 641..702 CDD:188822 38/60 (63%)
limd1aXP_021322480.1 LIM <1..37 CDD:295319 23/35 (66%)
LIM2_Ajuba_like 49..101 CDD:188741 40/51 (78%)
LIM3_Ajuba_like 109..170 CDD:188822 38/60 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 104 1.000 Domainoid score I6645
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004196
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.