DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jub and fhl3b

DIOPT Version :9

Sequence 1:NP_572930.3 Gene:jub / 32351 FlyBaseID:FBgn0030530 Length:728 Species:Drosophila melanogaster
Sequence 2:NP_001093448.1 Gene:fhl3b / 555053 ZFINID:ZDB-GENE-030131-8356 Length:290 Species:Danio rerio


Alignment Length:250 Identity:61/250 - (24%)
Similarity:100/250 - (40%) Gaps:41/250 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   487 EAQRKIEELTRQLEEEIEQSEEH------------------------------GEYFGICHTCGE 521
            |.:..||..:|:|..|.....|.                              .|:...|..||:
Zfish    42 ECKELIEHNSRELYHEDRHYHEQCFRCSRCSRSLAKESFTCQEDALVCNNCYCNEFSSNCVACGK 106

  Fly   522 KVKGAGQACQAMGNLYHTNCFICCSCGRALRGKAFYNVHGRVYCEEDYMYSGFQQTAEKCAICGH 586
            .|....:..:....::|..||:||.|.:.:..::|.......||..  .|.|  :.|.:||.|..
Zfish   107 TVMPGSKRLEYEDCVWHEECFVCCGCEQPIGAQSFIPDKDEYYCVP--CYEG--RFAPRCAHCKQ 167

  Fly   587 LIMEMILQAMGKSYHPGCFRCCVCNECLDGVPFTVDVDHKIYCVNDYHRMFAPKCASCGKGITPV 651
            .:::..:....:.:|..||.|..|...|.|.|||...:.. |||..:..::|.|||:|.|   |:
Zfish   168 TLVQGGVTYRDEPWHKECFLCTGCKVQLAGQPFTTQGEDP-YCVKCFSNLYAQKCAACEK---PI 228

  Fly   652 EGTDETVRVVSMDKDFHVDCYICEECGMQLTDEPDKRCYPLDGRLLCRGCHLQRL 706
            .|..|...|...::.:|..|:.|..|.:.|.   ....:|....:||:||:.::|
Zfish   229 TGFGEGKYVSFEERQWHKPCFKCSVCSLSLV---GAGFFPHGSMILCKGCNTKKL 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jubNP_572930.3 LIM1_Ajuba_like 516..569 CDD:188738 13/52 (25%)
LIM2_Ajuba_like 581..633 CDD:188741 16/51 (31%)
LIM3_Ajuba_like 641..702 CDD:188822 17/60 (28%)
fhl3bNP_001093448.1 LIM <5..33 CDD:295319
LIM1_FHL3 36..94 CDD:188807 7/51 (14%)
LIM2_FHL3 98..155 CDD:188811 13/58 (22%)
LIM3_FHL 162..213 CDD:188732 16/51 (31%)
LIM4_FHL3 221..276 CDD:188818 17/60 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.