Sequence 1: | NP_572930.3 | Gene: | jub / 32351 | FlyBaseID: | FBgn0030530 | Length: | 728 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001093448.1 | Gene: | fhl3b / 555053 | ZFINID: | ZDB-GENE-030131-8356 | Length: | 290 | Species: | Danio rerio |
Alignment Length: | 250 | Identity: | 61/250 - (24%) |
---|---|---|---|
Similarity: | 100/250 - (40%) | Gaps: | 41/250 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 487 EAQRKIEELTRQLEEEIEQSEEH------------------------------GEYFGICHTCGE 521
Fly 522 KVKGAGQACQAMGNLYHTNCFICCSCGRALRGKAFYNVHGRVYCEEDYMYSGFQQTAEKCAICGH 586
Fly 587 LIMEMILQAMGKSYHPGCFRCCVCNECLDGVPFTVDVDHKIYCVNDYHRMFAPKCASCGKGITPV 651
Fly 652 EGTDETVRVVSMDKDFHVDCYICEECGMQLTDEPDKRCYPLDGRLLCRGCHLQRL 706 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
jub | NP_572930.3 | LIM1_Ajuba_like | 516..569 | CDD:188738 | 13/52 (25%) |
LIM2_Ajuba_like | 581..633 | CDD:188741 | 16/51 (31%) | ||
LIM3_Ajuba_like | 641..702 | CDD:188822 | 17/60 (28%) | ||
fhl3b | NP_001093448.1 | LIM | <5..33 | CDD:295319 | |
LIM1_FHL3 | 36..94 | CDD:188807 | 7/51 (14%) | ||
LIM2_FHL3 | 98..155 | CDD:188811 | 13/58 (22%) | ||
LIM3_FHL | 162..213 | CDD:188732 | 16/51 (31%) | ||
LIM4_FHL3 | 221..276 | CDD:188818 | 17/60 (28%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |