DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jub and lims1

DIOPT Version :9

Sequence 1:NP_572930.3 Gene:jub / 32351 FlyBaseID:FBgn0030530 Length:728 Species:Drosophila melanogaster
Sequence 2:XP_021335295.1 Gene:lims1 / 554019 ZFINID:ZDB-GENE-050522-236 Length:345 Species:Danio rerio


Alignment Length:257 Identity:65/257 - (25%)
Similarity:93/257 - (36%) Gaps:85/257 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   516 CHTCGEKVKGAGQACQAMGNLYHTNCFICCSCGRALRGKAFYNVHGRVYCEEDYMYSGFQQT-AE 579
            |..|......|.:...:.|.|||..||:|..|.:......||...||.|||.|     ||.. |.
Zfish    21 CERCKSGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHD-----FQMLFAP 80

  Fly   580 KCAICGHLIMEMILQAMGKSYHPGCFRCCVCNECLDGVPFTVDV--------------------- 623
            .|..||..|:..:::||..|:||.||.|.:|...|..|.|..:.                     
Zfish    81 CCHQCGEFIIGRVIKAMNNSWHPDCFCCDICQAVLADVGFVKNAGRHLCRPCHNREKARGLGKYI 145

  Fly   624 ----------------------DH-------------------KIYCVNDYHRMFAPKCASCGKG 647
                                  ||                   ::||:..:.:|..|.|.:|.: 
Zfish   146 CQKCHAIIEEQPLIFKNDPYHPDHFNCSNCGKELTADARELKGELYCLPCHDKMGVPICGACRR- 209

  Fly   648 ITPVEGTDETVRVV-SMDKDFHVDCYICEECGMQLTDEP--DKRCYPLDGRLLCRGCHLQRL 706
              |:||     ||| :|.|.:||:.::|.:|     ::|  ..|.|...|...|. .|..:|
Zfish   210 --PIEG-----RVVNAMGKQWHVEHFVCAKC-----EKPFLGHRHYERKGLAYCE-THYNQL 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jubNP_572930.3 LIM1_Ajuba_like 516..569 CDD:188738 18/52 (35%)
LIM2_Ajuba_like 581..633 CDD:188741 20/113 (18%)
LIM3_Ajuba_like 641..702 CDD:188822 19/63 (30%)
lims1XP_021335295.1 LIM1_PINCH 21..79 CDD:188717 21/62 (34%)
LIM2_PINCH 82..133 CDD:188718 16/50 (32%)
LIM3_PINCH 146..196 CDD:188719 4/49 (8%)
LIM4_PINCH 202..255 CDD:188720 20/66 (30%)
LIM5_PINCH 263..316 CDD:188721
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.