DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jub and Prickle3

DIOPT Version :9

Sequence 1:NP_572930.3 Gene:jub / 32351 FlyBaseID:FBgn0030530 Length:728 Species:Drosophila melanogaster
Sequence 2:NP_001277553.1 Gene:Prickle3 / 54630 MGIID:1859635 Length:624 Species:Mus musculus


Alignment Length:297 Identity:70/297 - (23%)
Similarity:110/297 - (37%) Gaps:75/297 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   458 VNAALKPRR------GLTKNLLPYSVTPPRPAGPTEAQRKIEELTRQL--------------EEE 502
            |...|||.:      .|.::.:||..:|..       :.:|::|..||              |||
Mouse    96 VPPGLKPEQVYQFFSCLPEDKVPYVNSPGE-------KYRIKQLLHQLPPHDSEAQYCTALEEEE 153

  Fly   503 IEQ-----SEEHGEYFG--------------ICHTCGEKVKGAGQACQA----MGNLYHTNCFIC 544
            .::     .:...|..|              ||..||:::.|...|..|    :|..:|..||:|
Mouse   154 KKELRAFSQQRKRENLGRATVRIFPVTITGAICEECGKQIGGGDIAVFASRAGLGACWHPQCFVC 218

  Fly   545 CSCGRALRGKAFYNVHGRVYCEEDYMYSGFQQTAE----KCAICGHLIME-MILQAMGKSYHPGC 604
            .:|...|....::...|:|||...:        ||    :|..|..:|.. ...:|.|:.:|.|.
Mouse   219 TTCQELLVDLIYFYHAGKVYCGRHH--------AECLRPRCQACDEIIFSPECTEAEGRHWHMGH 275

  Fly   605 FRCCVCNECLDGVPFTVDVDHKIYCVNDYHRMFAPKCASCGKGITPVEGTDETVRVVSMDKDFHV 669
            |.|..|...|.|..:.:. ..:.:|...|....|..|..||:.|    |.|:. ::....:.:|.
Mouse   276 FCCFECEASLGGQRYVMR-QSRPHCCACYEARHAEYCDGCGEHI----GLDQG-QMAYEGQHWHA 334

  Fly   670 D--CYICEECGMQLTDEPDKRCYPLDGRLLC-RGCHL 703
            .  |:.|..|...|...|   ..|..|.:.| |.|.|
Mouse   335 SDRCFCCSRCSRPLLGRP---FLPRRGLIFCSRACSL 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jubNP_572930.3 LIM1_Ajuba_like 516..569 CDD:188738 17/56 (30%)
LIM2_Ajuba_like 581..633 CDD:188741 13/52 (25%)
LIM3_Ajuba_like 641..702 CDD:188822 16/63 (25%)
Prickle3NP_001277553.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
PET_Prickle 82..178 CDD:193602 17/88 (19%)
LIM1_Prickle 186..244 CDD:188799 17/65 (26%)
LIM2_Prickle 249..304 CDD:188802 13/55 (24%)
LIM3_Prickle 309..367 CDD:188804 16/65 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 371..617
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.